A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10223 |
Swiss-prot Accession number | Q98848 (Sequence in FASTA format) |
Description | Gonadotropin subunit beta-1 precursor (Gonadotropin beta-I chain)(GTH-I-beta) (Follicle-stimulating hormone-like GTH). |
Source organism | Carassius auratus (Goldfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Involved in gametogenesis and steroidogenesis |
Protein Length | 130 Amino acids |
Molecular weight | 14423 |
References | 1 PubMed abstract 9073500 2 PubMed abstract 9831661 3 PubMed abstract 9073500 4 PubMed abstract 9831661 |
Domain Name | Cys_knot |
Hormone Name | Gonadotropin subunit beta-1 |
Mature Hormone Sequence | GSECRSSCRLTNISITVESEECGSCITIDTTACAGLCKTQESVYRSPLMLSYQNTCNFREWTYETYEFKGCPARADSIFTYPVALSCECSKCNSDITDCGVLSQQTLGCNAH |
Position of mature hormone in Pre-Hormone protein | 112 Residues from position (19-130) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |