A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10209 |
Swiss-prot Accession number | Q9PS36 (Sequence in FASTA format) |
Description | Follitropin subunit beta (Follicle-stimulating hormone beta subunit)(FSH-beta) (FSH-B) (Follitropin beta chain). |
Source organism | Rana catesbeiana (Bull frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Stimulates development of follicle and spermatogenesis in the reproductive organs |
Protein Length | 107 Amino acids |
Molecular weight | 11794 |
References | 1 PubMed abstract 1426958 2 PubMed abstract 1426958 |
Domain Name | Cys_knot |
Hormone Name | Follicle-stimulating hormone beta subunit |
Mature Hormone Sequence | CELSNITIVLEKEECGACVSVNATWCSGYCYTKDANLMYPQKSEKQGVCTYTEVIYETVKIPGCAENVNPFYTYPVAVDCHCGRCDSETTDCTVRALGPTYCSLSQD |
Position of mature hormone in Pre-Hormone protein | 107 Residues from position (1-107) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |