A database of hormones and their receptors

Peptide Hormone

HMRbase accession number	10189
Swiss-prot Accession number	P87352 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Gamma-melanotropin-like segment; Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Melanotropin beta(Beta-MSH); Beta-endorphin; Met-enkephalin].
Source organism	Acipenser transmontanus (White sturgeon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Chondrostei; Acipenseriformes; Acipenseridae;Acipenser.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Precursor protein for pituitary hormones that regulate stress and environmental adaptation
Protein Length	263 Amino acids
Molecular weight	30163
References	1 PubMed abstract 9016801 2 PubMed abstract 9016801
Domain Name	NPP ACTH_domain Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPVGRKRRPVKVYPNGVEEESAESYPAEI
Position of mature hormone in Pre-Hormone protein	39 Residues from position (140-178)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated