A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10179 |
Swiss-prot Accession number | P81881 (Sequence in FASTA format) |
Description | Insulin [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Piaractus mesopotamicus (Pacu) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Characiformes;Characidae; Piaractus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 52 Amino acids |
Molecular weight | 5673 |
References | 1 PubMed abstract 10327603 |
Domain Name | Insulin |
Hormone Name | Insulin B chain |
Mature Hormone Sequence | NAGAPQHLCGSHLVDALYLVCGPSGFFYNPK |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (1-31) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |