A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10154 |
Swiss-prot Accession number | Q9GL60 (Sequence in FASTA format) |
Description | Somatotropin precursor (Growth hormone). |
Source organism | Monodelphis domestica (Short-tailed gray opossum) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues |
Protein Length | 215 Amino acids |
Molecular weight | 24384 |
References | 1 Kacsoh B.; "Cloning and characterization of pituitary growth hormone precursorcDNA from the marsupial, Monodelphis domestica."; Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Hormone_1 |
Hormone Name | Somatotropin |
Mature Hormone Sequence | FPAMPLSSLFANAVLRAQHLHQLVADTYKEFERTYIPEAQRHSIQSTQTAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLSPVQFLSRVFTNSLVFGTSDRVYEKLRDLEEGIQALMQELEDGSSRGGLVLKTTYDKFDTNLRSDEALLKNYGLLSCFKKDLHKAETYLRVMECRRFVESSCAF |
Position of mature hormone in Pre-Hormone protein | 190 Residues from position (26-215) |
Receptor | N/A |
Gene ID | 554243 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |