A database of hormones and their receptors
Peptide Hormone

Search Result - 1

HMRbase accession number10121
Swiss-prot Accession numberQ2Q1P1 (Sequence in FASTA format)
DescriptionLutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organismGorilla gorilla gorilla (Lowland gorilla)
Taxonomical ClassificationEukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Gorilla.
Subcellular locationSecreted protein
Developmental StageN/A
Similarity Belongs to the glycoprotein hormones subunit beta family.
Tissue SpecificityN/A
Post translational modification N/A
FunctionPromotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length141 Amino acids
Molecular weight15262
References1   Hallast P., Rull K., Laan M.; "What is the evidence for the functionality of CGB1 and CGB2?"; Submitted (OCT-2005) to the EMBL/GenBank/DDBJ databases.
Domain NameCys_knot  
Hormone NameLuteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone SequenceSREPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMMRVLQGVLPPLPQVVCTYRDVRFESIXLPGCPRGVDPMVSFPVALSCRCGPCHRSTSDCGGPNDHPLTCDHPQLSGLLFL
Position of mature hormone in Pre-Hormone protein121 Residues from position (21-141)
ReceptorN/A
Gene IDN/A
PDB IDN/A
Drugpediawiki
Comments!Receptor for this Hormone are either unknown or have not yet been curated