A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10117 |
| Swiss-prot Accession number | P80665 (Sequence in FASTA format) |
| Description | Glycoprotein hormones alpha chain (Anterior pituitary glycoproteinhormones common subunit alpha) (Follitropin alpha chain) (Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alpha chain)(Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropin alphachain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha). |
| Source organism | Struthio camelus (Ostrich) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 96 Amino acids |
| Molecular weight | 10782 |
| References | 1 PubMed abstract 8925835 |
| Domain Name | Hormone_6 |
| Hormone Name | Glycoprotein hormones alpha chain |
| Mature Hormone Sequence | FPDGEFLMQGCPECKLGENRFFSKPGAPVYQCTGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKAFTKITLKDNVKIENHTECHCSTCYYHKS |
| Position of mature hormone in Pre-Hormone protein | 96 Residues from position (1-96) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |