A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10105 |
Swiss-prot Accession number | P82373 (Sequence in FASTA format) |
Description | Diuretic hormone class 1 (Diuretic hormone class I) (Diuretic peptide)(DP) (DH(46)). |
Source organism | Diploptera punctata (Pacific beetle cockroach) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Orthopteroidea; Dictyoptera; Blattaria; Blaberidae;Diplopterinae; Diploptera. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Regulation of fluid secretion. Stimulates primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules. Has a greater effect on the transport of Na(+) then K(+) ions. In vitro, has synergistic effects with the smaller diuretic hormone DH(31) which co-occurs with it |
Protein Length | 46 Amino acids |
Molecular weight | 5322 |
References | 1 PubMed abstract 10841553 |
Domain Name | CRF |
Hormone Name | Diuretic hormone class 1 |
Mature Hormone Sequence | TGTGPSLSIVNPLDVLRQRLLLEIARRRMRQTQNMIQANRDFLESI |
Position of mature hormone in Pre-Hormone protein | 46 Residues from position (1-46) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |