A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10104 |
Swiss-prot Accession number | P82015 (Sequence in FASTA format) |
Description | Diuretic hormone 2 (DH-2) (Diuretic peptide 2) (DP-2) (DH(30)). |
Source organism | Hyles lineata (Whitelined sphinx moth) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Sphingoidea;Sphingidae; Macroglossinae; Hyles. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Regulation of fluid secretion. May stimulate primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules |
Protein Length | 30 Amino acids |
Molecular weight | 3575 |
References | 1 PubMed abstract 10696588 |
Domain Name | CRF |
Hormone Name | Diuretic hormone 2 |
Mature Hormone Sequence | SFSVNPAVEILQHRYMEKVAQNNRNFLNRV |
Position of mature hormone in Pre-Hormone protein | 30 Residues from position (1-30) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |