A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10097 |
Swiss-prot Accession number | P83486 (Sequence in FASTA format) |
Description | Crustacean hyperglycemic hormone B (CHHB). |
Source organism | Cherax destructor (Yabbie) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Parastacoidea; Parastacidae; Cherax. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
Tissue Specificity | N/A |
Post translational modification | Stereoinversion of L-Phe (in CHHB-I) to D-Phe (in CHHB-II). |
Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
Protein Length | 72 Amino acids |
Molecular weight | 8395 |
References | 1 PubMed abstract 15127939 |
Domain Name | Crust_neurohorm |
Hormone Name | Crustacean hyperglycemic hormone B |
Mature Hormone Sequence | QVFDQACKGVYDRAIFKKLDRVCDDCYNLYRKPYVATSCRQNCYSNLVFRQCLDDLLLVDVVDEYVSGVQIV |
Position of mature hormone in Pre-Hormone protein | 72 Residues from position (1-72) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |