A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10086 |
Swiss-prot Accession number | P01221 (Sequence in FASTA format) |
Description | Glycoprotein hormones alpha chain 1 precursor (Gonadotropin alphachain 1) (GTH-alpha). |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Involved in gametogenesis and steroidogenesis |
Protein Length | 118 Amino acids |
Molecular weight | 13533 |
References | 1 PubMed abstract 3246480 2 PubMed abstract 1370380 3 PubMed abstract 607993 |
Domain Name | Hormone_6 |
Hormone Name | Glycoprotein hormones alpha chain 1 |
Mature Hormone Sequence | YPRNDMNNFGCEECKLKENNIFSKPGAPVYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKEVKRVLVNDVKLVNHTDCHCSTCYYHKS |
Position of mature hormone in Pre-Hormone protein | 95 Residues from position (24-118) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |