A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10009 |
Swiss-prot Accession number | P09682 (Sequence in FASTA format) |
Description | Glucagon. |
Source organism | Hydrolagus colliei (Spotted ratfish) (Pacific ratfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Holocephali; Chimaeriformes; Chimaeridae; Hydrolagus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | Produced by the X-cells of the islets of pancreas |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 36 Amino acids |
Molecular weight | 4236 |
References | 1 PubMed abstract 3311036 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon |
Mature Hormone Sequence | HTDGIFSSDYSKYLDNRRTKDFVQWLLSTKRNGANT |
Position of mature hormone in Pre-Hormone protein | 36 Residues from position (1-36) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |