![]() |
|
|
|
|
|
|
HMRbase accession number | 11520 |
Swiss-prot Accession number | Q9YGP3 (Sequence in FASTA format) |
Description | Glycoprotein hormones alpha chain precursor (Gonadotropin alpha chain)(GTH-alpha). |
Source organism | Ictalurus punctatus (Channel catfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes;Ictaluridae; Ictalurus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Involved in gametogenesis and steroidogenesis |
Protein Length | 116 Amino acids |
Molecular weight | 13089 |
References | 1 PubMed abstract 9284560 |
Domain Name | Hormone_6 |
Hormone Name | Glycoprotein hormones alpha chain |
Mature Hormone Sequence | FPNNDFGCEECKLKENNIFSKPGAPVYQCMGCCFSRAYPTPLRSEKTMLVPKNITSEATCCVAKEVKRVIVNDVKLMNHTDCHCSTCYYHKF |
Position of mature hormone in Pre-Hormone protein | 92 Residues from position (25-116) |
Receptor | Q6QMG1 Detail in HMRbase Q98T84 Detail in HMRbase Q98T85 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |