![]() |
|
|
|
|
|
|
HMRbase accession number | 11493 |
Swiss-prot Accession number | P63292 (Sequence in FASTA format) |
Description | Somatoliberin precursor (Growth hormone-releasing factor) (GRF)(Growth hormone-releasing hormone) (GHRH). |
Source organism | Bos taurus (Bovine) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone |
Protein Length | 106 Amino acids |
Molecular weight | 12058 |
References | 1 Zhou P., Kazmer G.W., Yang X.; Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 6421287 |
Domain Name | Hormone_2 |
Hormone Name | Somatoliberin |
Mature Hormone Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL |
Position of mature hormone in Pre-Hormone protein | 44 Residues from position (31-74) |
Receptor | Q9BDH9 Detail in HMRbase Q9N1F8 Detail in HMRbase Q9TUJ0 Detail in HMRbase Q9TUJ1 Detail in HMRbase |
Gene ID | 281191 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |