HMRbase accession number | 11456 |
Swiss-prot Accession number | P41534 (Sequence in FASTA format) |
Description | Glucagon family neuropeptides precursor [Contains: Growth hormone-releasing factor 1-46 (GRF) (Growth hormone-releasing hormone) (GHRH);Pituitary adenylate cyclase-activating polypeptide 27 (PACAP-27)(PACAP27); Pituitary adenylate cyclase-activating polypeptide 38(PACAP-38) (PACAP38)]. |
Source organism | Gallus gallus (Chicken) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | PACAP plays pivotal roles as a neurotransmitter and/or a neuromodulator |
Protein Length | 175 Amino acids |
Molecular weight | 19561 |
References | 1 PubMed abstract 9022048 2 Yasuhara T., Mizuno K., Somogyvari-Vigh A., Komaki G., Arimura A.; "Isolation and primary structure of chicken PACAP."; Regul. Pept. 37:326-326(1992).
|
Domain Name | Hormone_2 |
Hormone Name | Pituitary adenylate cyclase-activating polypeptide 38 |
Mature Hormone Sequence | HIDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK |
Position of mature hormone in Pre-Hormone protein | 38 Residues from position (131-168) |
Receptor | Q7ZZJ9 Detail in HMRbase Q309X7
Detail in HMRbase
|
Gene ID | 408251 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | |