![]() |
|
|
|
|
|
|
HMRbase accession number | 11390 |
Swiss-prot Accession number | P09240 (Sequence in FASTA format) |
Description | Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 33(CCK33); Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)]. |
Source organism | Mus musculus (Mouse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | The precursor cleaved by enzymes to produce a number of active cholecystokinins. |
Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion |
Protein Length | 115 Amino acids |
Molecular weight | 12866 |
References | 1 PubMed abstract 2011497 2 PubMed abstract 3862083 |
Domain Name | Gastrin |
Hormone Name | Cholecystokinin |
Mature Hormone Sequence | QPVVPAEATDPVEQRAEEAPRRQLRAVLRPDREPRARLGALLARYIQQVRKAPSGRMSVLKNLQSLDPSHRISDRDYMGWMDFGRRSAEDYEYPS |
Position of mature hormone in Pre-Hormone protein | 95 Residues from position (21-115) |
Receptor | P56481 Detail in HMRbase O08786 Detail in HMRbase Q3TPL0 Detail in HMRbase Q3ZB46 Detail in HMRbase Q3ZB53 Detail in HMRbase Q8BKF6 Detail in HMRbase |
Gene ID | 12424 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |