A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11374 |
Swiss-prot Accession number | P06307 (Sequence in FASTA format) |
Description | Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)]. |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | The precursor cleaved by enzymes to produce a number of active cholecystokinins. |
Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion |
Protein Length | 115 Amino acids |
Molecular weight | 12669 |
References | 1 PubMed abstract 3856870 2 Kato K., Takahashi Y., Matsubara K.; "Molecular cloning of the human cholecystokinin gene."; Ann. N. Y. Acad. Sci. 448:613-615(1985). 3 Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,Phelan M., Farmer A.; "Cloning of human full-length CDSs in BD Creator(TM) system donorvector."; Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases. 4 Livingston R.J., Rieder M.J., Chung M.-W., Ritchie T.K., Olson A.N.,Nguyen C.P., Nguyen D.A., Poel C.L., Robertson P.D., Schackwitz W.S.,Sherwood J.K., Sherwood A.M., Leithauser B.J., Nickerson D.A.; "NIEHS-SNPs, environmental genome project, NIEHS ES15478, Departmentof Genome Sciences, Seattle, WA (URL: http://egp.gs.washington.edu)."; Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases. 5 PubMed abstract 15489334 6 PubMed abstract 11076522 |
Domain Name | Gastrin |
Hormone Name | Cholecystokinin-39 |
Mature Hormone Sequence | YIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF |
Position of mature hormone in Pre-Hormone protein | 39 Residues from position (65-103) |
Receptor | P32239 Detail in HMRbase P32238 Detail in HMRbase |
Gene ID | 885 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |