![]() |
|
|
|
|
|
|
HMRbase accession number | 10359 |
Swiss-prot Accession number | Q9PTS1 (Sequence in FASTA format) |
Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
Source organism | Carassius auratus (Goldfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
Protein Length | 162 Amino acids |
Molecular weight | 18418 |
References | 1 PubMed abstract 10603283 |
Domain Name | CRF |
Hormone Name | Corticoliberin |
Mature Hormone Sequence | SEEPPISLDLTFHLLREVLEMARAEQMAQQAHSNRKMMEIF |
Position of mature hormone in Pre-Hormone protein | 41 Residues from position (120-160) |
Receptor | Q49MT7 Detail in HMRbase Q49MT8 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |