![]() |
|
|
|
|
|
|
HMRbase accession number | 10315 |
Swiss-prot Accession number | Q04618 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin B precursor (Pro-opiomelanocortin B) (POMC B)[Contains: NPP 2; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 2 (Alpha-MSH 2); Corticotropin-like intermediarypeptide 2 (CLIP-2); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 2 (Beta-MSH 2); Beta-endorphin 2; Met-enkephalin]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | N/A |
Developmental Stage | Expressed only in sexually active fish. |
Similarity | Belongs to the POMC family. |
Tissue Specificity | Pituitary and hypothalamus of adult diploid animals |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
Function | N/A |
Protein Length | 240 Amino acids |
Molecular weight | 26719 |
References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Corticotropin |
Mature Hormone Sequence | SYSMEHFRWGKPIGHKRRPIKVYASSLEGGDSSEGTFPLQA |
Position of mature hormone in Pre-Hormone protein | 41 Residues from position (112-152) |
Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
Gene ID | 100136772 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |