![]() |
|
|
|
|
|
|
HMRbase accession number | 10166 |
Swiss-prot Accession number | Q28376 (Sequence in FASTA format) |
Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
Source organism | Equus caballus (Horse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Indispensable for the control of thyroid structure and metabolism |
Protein Length | 138 Amino acids |
Molecular weight | 15663 |
References | 1 Kania S.A., Olchowy T.W., Frank L.A.; Submitted (MAR-1996) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Cys_knot |
Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
Mature Hormone Sequence | FCIPTEYMMHVERKECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFMYKTVEIPGCPDHVTPYFSYPVAVSCKCGKCNTDYSDCIHEAIKANYCTKPQKSY |
Position of mature hormone in Pre-Hormone protein | 112 Residues from position (21-132) |
Receptor | N/A |
Gene ID | 100034188 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10301 |
Swiss-prot Accession number | P54828 (Sequence in FASTA format) |
Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
Source organism | Canis familiaris (Dog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Indispensable for the control of thyroid structure and metabolism |
Protein Length | 138 Amino acids |
Molecular weight | 15666 |
References | 1 Kania S.A., Frank L.A.; Submitted (MAR-1996) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Cys_knot |
Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
Mature Hormone Sequence | FCFPTEYTMHVERKECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFMYKTVEIPGCPRHVTPYFSYPVAVSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSY |
Position of mature hormone in Pre-Hormone protein | 112 Residues from position (21-132) |
Receptor | P14763
Detail in HMRbase |
Gene ID | 403973 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10325 |
Swiss-prot Accession number | Q52R90 (Sequence in FASTA format) |
Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
Source organism | Felis silvestris catus (Cat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Indispensable for the control of thyroid structure and metabolism |
Protein Length | 138 Amino acids |
Molecular weight | 15483 |
References | 1 PubMed abstract 16122898 |
Domain Name | Cys_knot |
Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
Mature Hormone Sequence | FCFPTEYMMHVERKECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFLYKTVEIPGCPHHVTPYFSYPVAVSCKCGKCNTDYSDCIHEAIKTNDCTKPQKSD |
Position of mature hormone in Pre-Hormone protein | 112 Residues from position (21-132) |
Receptor | Q9BGN4
Detail in HMRbase |
Gene ID | 554350 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10774 |
Swiss-prot Accession number | Q08127 (Sequence in FASTA format) |
Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
Source organism | Anguilla anguilla (European freshwater eel) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Anguilliformes; Anguillidae;Anguilla. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Indispensable for the control of thyroid structure and metabolism. May play some role in the biological processes of the immature fishes |
Protein Length | 147 Amino acids |
Molecular weight | 16156 |
References | 1 PubMed abstract 8044698 2 PubMed abstract 1933511 |
Domain Name | Cys_knot |
Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
Mature Hormone Sequence | ICSPVDYTLYVEKPECDFCVAINTTICMGFCYSLDPNVVGPAVKRLVVQRGCTYQAVEYRTAELPGCPPHVDPRFSYPVALHCTCRACDPARDECTHRASADGDRCSKPLLLHMHAYPGQSNYIQTL |
Position of mature hormone in Pre-Hormone protein | 127 Residues from position (21-147) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10775 |
Swiss-prot Accession number | Q7ZZV4 (Sequence in FASTA format) |
Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
Source organism | Anguilla japonica (Japanese eel) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Anguilliformes; Anguillidae;Anguilla. |
Subcellular location | Secreted protein (By similarity) |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Indispensable for the control of thyroid structure and metabolism. May play some role in the biological processes of the immature fishes |
Protein Length | 147 Amino acids |
Molecular weight | 16088 |
References | 1 Han Y.-S., Liao I.-C., Tzeng W.-N., Huang Y.-S., Yu J.Y.-L.; "Molecular cloning of the genomic DNA and cDNA encoding thyroidstimulating hormone beta subunit of the Japanese eel and its geneexpression."; Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases.
2 Nagae M., Qu X.C., Kazeto Y., Ijiri S., Ito F., Adachi S.,Yamauchi K.; "Molecular cloning of Japanese eel TSH beta."; Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases. |
Domain Name | Cys_knot |
Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
Mature Hormone Sequence | ICSPVDYTLYVEKPECDFCVAINTTICMGFCYSLDPNVVGPAVKRLAVQRGCTYQAVEYRTAELPGCPPHVDPRFSYPVALHCTCRACDPARDECTHRASADGDRCSKPLLLHMHAYPGQSNHIQTL |
Position of mature hormone in Pre-Hormone protein | 127 Residues from position (21-147) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10778 |
Swiss-prot Accession number | P79357 (Sequence in FASTA format) |
Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
Source organism | Lama glama (Llama) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Tylopoda;Camelidae; Lama. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Indispensable for the control of thyroid structure and metabolism |
Protein Length | 138 Amino acids |
Molecular weight | 15571 |
References | 1 Kania S.A., Frank L.A., Odom T.F.; Submitted (FEB-1997) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Cys_knot |
Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
Mature Hormone Sequence | FCIPTEYMMHVERKECAYCLTINTTICAGYCMTRDFNGKLFLPKFALSQDVCTYRDFMYKTVEIPGCPHHVTPYFSYPVAVSCKCGKCDTDYSDCIQEAVKMNYCTKPQKPH |
Position of mature hormone in Pre-Hormone protein | 112 Residues from position (21-132) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10779 |
Swiss-prot Accession number | Q95J88 (Sequence in FASTA format) |
Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
Source organism | Monodelphis domestica (Short-tailed gray opossum) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Indispensable for the control of thyroid structure and metabolism |
Protein Length | 138 Amino acids |
Molecular weight | 15398 |
References | 1 Kacsoh B.; "Cloning and characterization of the cDNA encoding pituitary thyroidstimulating hormone (TSH, thyrotropin) beta of the marsupial,Monodelphis domestica."; Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Cys_knot |
Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
Mature Hormone Sequence | LCVPTGYTMHIERRECAYCLTINTTICAGYCMTRDSNGKLFLPKSALSQDVCTYRDVIYRTVVMPGCPPHVIPYISYPVAVSCRCGKCNTDYIDCIHESVTTNYCTKPQKPY |
Position of mature hormone in Pre-Hormone protein | 112 Residues from position (21-132) |
Receptor | N/A |
Gene ID | 503501 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10780 |
Swiss-prot Accession number | P37240 (Sequence in FASTA format) |
Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | Pituitary gland. Higher levels seen in immature fishes than the mature fishes |
Post translational modification | N/A |
Function | Indispensable for the control of thyroid structure and metabolism. May play some role in the biological processes of the immature fishes |
Protein Length | 147 Amino acids |
Molecular weight | 16440 |
References | 1 PubMed abstract 8327483 |
Domain Name | Cys_knot |
Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
Mature Hormone Sequence | MCVPTDYTLYEERRECDFCVAINTTICMGFCYSRDSNMKELAGPRFLIQRGCTYDQVEYRTVILPGCPLHANPLFTYPVALSCHCGTCNTDSDECAHKASSGDGARCSKPLRHIYPYPGLNSYIHPN |
Position of mature hormone in Pre-Hormone protein | 127 Residues from position (21-147) |
Receptor | N/A |
Gene ID | 100136289 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10781 |
Swiss-prot Accession number | O73824 (Sequence in FASTA format) |
Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
Source organism | Salmo salar (Atlantic salmon) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Salmo. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Indispensable for the control of thyroid structure and metabolism. May play some role in the biological processes of the immature fishes |
Protein Length | 139 Amino acids |
Molecular weight | 15449 |
References | 1 Martin S.A.M., Wallner W., Youngson A.F., Smith T.; "Differential expression of Atlantic salmon (Salmo salar) thyrotropinbeta subunit mRNA and its cDNA sequence."; J. Fish Biol. 54:757-766(1998).
|
Domain Name | Cys_knot |
Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
Mature Hormone Sequence | MCVPTDYTLYEERRECDFCVAINTTICMGFCYSRDSNMKELAGPRFLIQRGCTYDQVEYRTVILPGCPLHANPLFTYPVALSCHCGTCNTDSDECAHKASSGDGARCSKPLRHIYHTLA |
Position of mature hormone in Pre-Hormone protein | 119 Residues from position (21-139) |
Receptor | N/A |
Gene ID | 100136355 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11305 |
Swiss-prot Accession number | P01222 (Sequence in FASTA format) |
Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain) (Thyrotropinalfa). |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Indispensable for the control of thyroid structure and metabolism |
Protein Length | 138 Amino acids |
Molecular weight | 15609 |
References | 1 PubMed abstract 3839756 2 PubMed abstract 2457586 3 PubMed abstract 3234176 4 PubMed abstract 3243440 5 PubMed abstract 8196184 6 PubMed abstract 15489334 7 PubMed abstract 890569 |
Domain Name | Cys_knot |
Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
Mature Hormone Sequence | FCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSY |
Position of mature hormone in Pre-Hormone protein | 112 Residues from position (21-132) |
Receptor | P16473
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11306 |
Swiss-prot Accession number | P01223 (Sequence in FASTA format) |
Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
Source organism | Bos taurus (Bovine) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Indispensable for the control of thyroid structure and metabolism |
Protein Length | 138 Amino acids |
Molecular weight | 15624 |
References | 1 PubMed abstract 6325416 2 PubMed abstract 5101174 3 PubMed abstract 5101173 4 PubMed abstract 8670056 |
Domain Name | Cys_knot |
Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
Mature Hormone Sequence | FCIPTEYMMHVERKECAYCLTINTTVCAGYCMTRDVNGKLFLPKYALSQDVCTYRDFMYKTAEIPGCPRHVTPYFSYPVAISCKCGKCNTDYSDCIHEAIKTNYCTKPQKSY |
Position of mature hormone in Pre-Hormone protein | 112 Residues from position (21-132) |
Receptor | Q27987
Detail in HMRbase |
Gene ID | 281552 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11307 |
Swiss-prot Accession number | P01224 (Sequence in FASTA format) |
Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
Source organism | Sus scrofa (Pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Indispensable for the control of thyroid structure and metabolism |
Protein Length | 138 Amino acids |
Molecular weight | 15761 |
References | 1 PubMed abstract 2473932 2 PubMed abstract 8880412 3 PubMed abstract 1245181 |
Domain Name | Cys_knot |
Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
Mature Hormone Sequence | FCIPTEYMMHVERKECAYCLTINTTICAGYCMTRDFNGKLFLPKYALSQDVCTYRDFMYKTVEIPGCPHHVTPYFSYPVAISCKCGKCNTDYSDCIHEAIKTNYCTKPQKSY |
Position of mature hormone in Pre-Hormone protein | 112 Residues from position (21-132) |
Receptor | Q8SPP9
Detail in HMRbase |
Gene ID | 397658 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11367 |
Swiss-prot Accession number | P04652 (Sequence in FASTA format) |
Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
Source organism | Rattus norvegicus (Rat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Indispensable for the control of thyroid structure and metabolism |
Protein Length | 138 Amino acids |
Molecular weight | 15505 |
References | 1 PubMed abstract 6086256 2 PubMed abstract 3839124 3 PubMed abstract 3017658 4 PubMed abstract 3027091 5 PubMed abstract 15489334 6 Kato Y., Ezashi T., Hirai T., Kato T.; "Strain difference in nucleotide sequences of rat glycoprotein hormonesubunit cDNAs and gene fragment."; Zool. Sci. 7:877-885(1990). |
Domain Name | Cys_knot |
Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
Mature Hormone Sequence | FCIPTEYMMYVDRRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFTYRTVEIPGCPHHVAPYFSYPVALSCKCGKCNTDYSDCTHEAVKTNYCTKPQTFY |
Position of mature hormone in Pre-Hormone protein | 112 Residues from position (21-132) |
Receptor | P21463
Detail in HMRbase |
Gene ID | 25653 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11401 |
Swiss-prot Accession number | P12656 (Sequence in FASTA format) |
Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
Source organism | Mus musculus (Mouse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Indispensable for the control of thyroid structure and metabolism |
Protein Length | 138 Amino acids |
Molecular weight | 15373 |
References | 1 PubMed abstract 3349902 2 PubMed abstract 2824501 3 PubMed abstract 6207569 4 PubMed abstract 2484718 |
Domain Name | Cys_knot |
Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
Mature Hormone Sequence | FCIPTEYTMYVDRRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPHHVTPYFSFPVAVSCKCGKCNTDNSDCIHEAVRTNYCTKPQSFY |
Position of mature hormone in Pre-Hormone protein | 112 Residues from position (21-132) |
Receptor | P47750
Detail in HMRbase |
Gene ID | 22094 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |