![]() |
|
|
|
|
|
|
HMRbase accession number | 10244 |
Swiss-prot Accession number | Q9I954 (Sequence in FASTA format) |
Description | Thymosin beta-b. |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | Cytoplasm (By similarity) |
Developmental Stage | N/A |
Similarity | Belongs to the thymosin beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
Protein Length | 43 Amino acids |
Molecular weight | 4970 |
References | 1 Fujiki K., Nakao M., Shin D., Yano T.; "Molecular cloning of carp (Cyprinus carpio) thymosin beta b."; Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Thymosin |
Hormone Name | Thymosin beta-b |
Mature Hormone Sequence | ADKPDISEVSQFDKTKLKKTETQEKNTLPTKETIEQEKQCEA |
Position of mature hormone in Pre-Hormone protein | 42 Residues from position (2-43) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |