![]() |
|
|
|
|
|
|
HMRbase accession number | 10032 |
Swiss-prot Accession number | P47932 (Sequence in FASTA format) |
Description | Prorelaxin 1 precursor [Contains: Relaxin B chain; Relaxin A chain]. |
Source organism | Mus musculus (Mouse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals |
Protein Length | 185 Amino acids |
Molecular weight | 20571 |
References | 1 PubMed abstract 8452637 2 PubMed abstract 8216305 |
Domain Name | Insulin |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | RVSEEWMDGFIRMCGREYARELIKICGASVGRLAL |
Position of mature hormone in Pre-Hormone protein | 35 Residues from position (23-57) |
Receptor | Q91ZZ5
Detail in HMRbase |
Gene ID | 19773 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10034 |
Swiss-prot Accession number | Q9TRM8 (Sequence in FASTA format) |
Description | Prorelaxin precursor [Contains: Relaxin B chain; Relaxin A chain]. |
Source organism | Canis familiaris (Dog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | Placenta; syncytiotrophoblast |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals |
Protein Length | 177 Amino acids |
Molecular weight | 20563 |
References | 1 PubMed abstract 10026098 2 PubMed abstract 1388669 |
Domain Name | Insulin |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | TDDKKLKACGRDYVRLQIEVCGSIWWGRKAGQLRE |
Position of mature hormone in Pre-Hormone protein | 35 Residues from position (26-60) |
Receptor | Q5XM32
Detail in HMRbase |
Gene ID | 403742 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10060 |
Swiss-prot Accession number | Q7M3C4 (Sequence in FASTA format) |
Description | Relaxin B chain. |
Source organism | Phocoenoides dalli dalli (Dall's porpoise) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Odontoceti; Phocoenidae; Phocoenoides. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals |
Protein Length | 31 Amino acids |
Molecular weight | 3538 |
References | 1 Woods A.S., Cotter R.J., Yoshioka M., Buellesbach E., Schwabe C.; "Enzymatic digestion on the sample foil as a method for sequencedetermination by plasma desorption mass spectrometry: the primarystructure of porpoise relaxin."; Int. J. Mass Spectrom. Ion Process. 111:77-88(1991).
|
Domain Name | N/A |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | QRTNDFIKACGRELVRVWVEICGSVSWGRTA |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (1-31) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10292 |
Swiss-prot Accession number | Q9MYK8 (Sequence in FASTA format) |
Description | Prorelaxin precursor (RXN) [Contains: Relaxin B chain; Relaxin Achain]. |
Source organism | Felis silvestris catus (Cat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis. |
Subcellular location | Secreted (By similarity) |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | Expressed by the placenta. Exclusively detected in cells located in the lamellar placental labyrinth and absent from other placental and nonplacental uterine parts |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals |
Protein Length | 180 Amino acids |
Molecular weight | 20360 |
References | 1 PubMed abstract 9915995 |
Domain Name | Insulin |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | QEEVLKACGREFVRLQIRICGSLSWG |
Position of mature hormone in Pre-Hormone protein | 26 Residues from position (26-51) |
Receptor | N/A |
Gene ID | 493883 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10294 |
Swiss-prot Accession number | Q64171 (Sequence in FASTA format) |
Description | Prorelaxin precursor [Contains: Relaxin B chain; Relaxin A chain]. |
Source organism | Mesocricetus auratus (Golden hamster) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Cricetidae; Cricetinae; Mesocricetus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. It bears mature young, and allows separation of the pelvic bones |
Protein Length | 177 Amino acids |
Molecular weight | 20007 |
References | 1 PubMed abstract 7492700 |
Domain Name | Insulin |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | RVTKEWLDEVIHVCGREYVRAILDICAATVGLEAPPL |
Position of mature hormone in Pre-Hormone protein | 37 Residues from position (23-59) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11208 |
Swiss-prot Accession number | P51454 (Sequence in FASTA format) |
Description | Prorelaxin H1 precursor [Contains: Relaxin B chain; Relaxin A chain](Fragment). |
Source organism | Pan troglodytes (Chimpanzee) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pan. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | Expressed in the corpus luteum of pregnancy but not in the placenta |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix |
Protein Length | 166 Amino acids |
Molecular weight | 18731 |
References | 1 PubMed abstract 8182365 |
Domain Name | Insulin |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | DSWMDEVIKLCGRELVRAQIAICGMSTWS |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (6-34) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11210 |
Swiss-prot Accession number | P01347 (Sequence in FASTA format) |
Description | Prorelaxin 1 precursor [Contains: Relaxin B chain; Relaxin A chain]. |
Source organism | Rattus norvegicus (Rat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals |
Protein Length | 186 Amino acids |
Molecular weight | 20489 |
References | 1 PubMed abstract 7231533 2 PubMed abstract 14659888 3 PubMed abstract 7004862 |
Domain Name | Insulin |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | RVSEEWMDQVIQVCGRGYARAWIEVCGASVGRLAL |
Position of mature hormone in Pre-Hormone protein | 35 Residues from position (23-57) |
Receptor | N/A |
Gene ID | 25616 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11212 |
Swiss-prot Accession number | P51455 (Sequence in FASTA format) |
Description | Prorelaxin H2 precursor [Contains: Relaxin B chain; Relaxin A chain](Fragment). |
Source organism | Pan troglodytes (Chimpanzee) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pan. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | Expressed in the corpus luteum of pregnancy and in the placenta |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix |
Protein Length | 166 Amino acids |
Molecular weight | 18761 |
References | 1 PubMed abstract 8182365 2 PubMed abstract 8735594 |
Domain Name | Insulin |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | DSWMDEVIKLCGRELVRAQIAICGKSTWS |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (6-34) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11214 |
Swiss-prot Accession number | P11184 (Sequence in FASTA format) |
Description | Relaxin [Contains: Relaxin B chain; Relaxin A chain]. |
Source organism | Balaenoptera acutorostrata (Minke whale) (Lesser rorqual) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals |
Protein Length | 54 Amino acids |
Molecular weight | 6098 |
References | 1 PubMed abstract 2910872 |
Domain Name | Insulin |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | QSTNDLIKACGRELVRLWVEICGSVRWGQSAL |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (1-32) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11216 |
Swiss-prot Accession number | P11185 (Sequence in FASTA format) |
Description | Relaxin [Contains: Relaxin B chain; Relaxin A chain]. |
Source organism | Balaenoptera edeni (Pigmy Bryde's whale) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals |
Protein Length | 54 Amino acids |
Molecular weight | 6071 |
References | 1 PubMed abstract 2910872 |
Domain Name | Insulin |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | QSTNDLIKACGRELVRLWVEICGSVSWGRTAL |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (1-32) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11217 |
Swiss-prot Accession number | P22969 (Sequence in FASTA format) |
Description | Prorelaxin precursor (RXN) [Contains: Relaxin B chain; Relaxin Achain]. |
Source organism | Equus caballus (Horse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals |
Protein Length | 182 Amino acids |
Molecular weight | 20721 |
References | 1 Min K., Shiota K., Ogawa T.; "Molecular cloning of equine preprorelaxin cDNA."; J. Reprod. Dev. 42:171-178(1996).
2 PubMed abstract 7543295 3 PubMed abstract 2055195 |
Domain Name | Insulin |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | QKPDDVIKACGRELARLRIEICGSLSWK |
Position of mature hormone in Pre-Hormone protein | 28 Residues from position (26-53) |
Receptor | N/A |
Gene ID | 100033823 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11219 |
Swiss-prot Accession number | P19884 (Sequence in FASTA format) |
Description | Prorelaxin precursor [Contains: Relaxin B chain; Relaxin A chain]. |
Source organism | Macaca mulatta (Rhesus macaque) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix |
Protein Length | 185 Amino acids |
Molecular weight | 20895 |
References | 1 PubMed abstract 2590381 |
Domain Name | Insulin |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | AKWMDDVIKACGRELVRAQIAICGKSTLG |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (25-53) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11221 |
Swiss-prot Accession number | P01348 (Sequence in FASTA format) |
Description | Prorelaxin precursor [Contains: Relaxin B chain; Relaxin A chain]. |
Source organism | Sus scrofa (Pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals |
Protein Length | 182 Amino acids |
Molecular weight | 20818 |
References | 1 PubMed abstract 6897721 2 PubMed abstract 2442155 3 PubMed abstract 876374 4 PubMed abstract 851452 5 PubMed abstract 843375 6 PubMed abstract 938497 7 PubMed abstract 887933 8 PubMed abstract 622170 |
Domain Name | Insulin |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | QSTNDFIKACGRELVRLWVEICGSVSWGRTAL |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (25-56) |
Receptor | N/A |
Gene ID | 396891 |
PDB ID | 1RLX 2RLX 3RLX 4RLX |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11223 |
Swiss-prot Accession number | P11952 (Sequence in FASTA format) |
Description | Relaxin [Contains: Relaxin B chain; Relaxin A chain]. |
Source organism | Raja erinacea (Little skate) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Squalea; Hypnosqualea; Pristiorajea; Batoidea;Rajiformes; Rajidae; Leucoraja. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 64 Amino acids |
Molecular weight | 7499 |
References | 1 PubMed abstract 3827922 |
Domain Name | Insulin |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | RPNWEERSRLCGRDLIRAFIYLCGGTRWTRLPNFGNYPIM |
Position of mature hormone in Pre-Hormone protein | 40 Residues from position (1-40) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11225 |
Swiss-prot Accession number | P11953 (Sequence in FASTA format) |
Description | Relaxin [Contains: Relaxin B chain; Relaxin A chain]. |
Source organism | Squalus acanthias (Spiny dogfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Squalea; Hypnosqualea; Squaliformes; Squaloidei;Squalidae; Squalus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | The function of relaxin in an oviparous species is not yet known |
Protein Length | 54 Amino acids |
Molecular weight | 5910 |
References | 1 PubMed abstract 3780747 |
Domain Name | Insulin |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | QSFKNAEPGIKLCGREFIRAVIYTCGGSRW |
Position of mature hormone in Pre-Hormone protein | 30 Residues from position (1-30) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11362 |
Swiss-prot Accession number | P04090 (Sequence in FASTA format) |
Description | Prorelaxin H2 precursor [Contains: Relaxin B chain; Relaxin A chain]. |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | Isoform 1 expressed in the ovary during pregnancy. Also expressed in placenta, decidua and prostate. Isoform 2 relatively abundant in placenta, much lower abundance in the prostate gland. Not detected in the ovary |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix |
Protein Length | 185 Amino acids |
Molecular weight | 21043 |
References | 1 PubMed abstract 6548702 2 PubMed abstract 15164053 3 PubMed abstract 15489334 4 PubMed abstract 8735594 5 PubMed abstract 10601981 6 PubMed abstract 1572287 7 PubMed abstract 2076464 8 PubMed abstract 2040595 9 PubMed abstract 1656049 |
Domain Name | Insulin |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | DSWMEEVIKLCGRELVRAQIAICGMSTWS |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (25-53) |
Receptor | Q9HBX9 Detail in HMRbase Q8WXD0 Detail in HMRbase |
Gene ID | 6019 |
PDB ID | 6RLX |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11369 |
Swiss-prot Accession number | P04808 (Sequence in FASTA format) |
Description | Prorelaxin H1 precursor [Contains: Relaxin B chain; Relaxin A chain]. |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | Prostate. Not expressed in placenta, decidua or ovary |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix |
Protein Length | 185 Amino acids |
Molecular weight | 21146 |
References | 1 PubMed abstract 6548702 2 PubMed abstract 6298628 3 PubMed abstract 15164053 4 PubMed abstract 15489334 5 PubMed abstract 8735594 6 PubMed abstract 10601981 |
Domain Name | Insulin |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | VAAKWKDDVIKLCGRELVRAQIAICGMSTWS |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (23-53) |
Receptor | Q9HBX9 Detail in HMRbase Q8WXD0 Detail in HMRbase |
Gene ID | 6013 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |