![]() |
|
|
|
|
|
|
HMRbase accession number | 10224 |
Swiss-prot Accession number | Q91364 (Sequence in FASTA format) |
Description | Prolactin-2 precursor (Prolactin II) (PRL-II). |
Source organism | Oncorhynchus tschawytscha (Chinook salmon) (King salmon) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 210 Amino acids |
Molecular weight | 23457 |
References | 1 PubMed abstract 1308811 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin-2 |
Mature Hormone Sequence | IGLSDLMERASQRSDKLHSLSTSLNKDLDSHFPPMGRVMMPRPSMCHTSSLQIPKDKEQALRVSENELISLARSLLLAWNDPLLLLSSEAPTLPHPSNGDISSKIRELQDYSKSLGDGLDILVNKMGPSSQYISLIPFKGGDLGNDKTSRLINFHFLMSCFRRDSHKIDSFLKVLRCRATKMRPETC |
Position of mature hormone in Pre-Hormone protein | 187 Residues from position (24-210) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10420 |
Swiss-prot Accession number | P09584 (Sequence in FASTA format) |
Description | Prolactin-2 precursor (Prolactin II) (PRL-II). |
Source organism | Oncorhynchus keta (Chum salmon) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 210 Amino acids |
Molecular weight | 23431 |
References | 1 Kuwana Y., Kuga T., Sekine S., Sato M., Kawauchi H., Itoh S.; "Cloning and expression of cDNA for salmon prolactin in Escherichiacoli."; Agric. Biol. Chem. 52:1033-1039(1988).
2 PubMed abstract 3947078 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin-2 |
Mature Hormone Sequence | IGLSDLMERASQRSDKLHSLSTSLNKDLDSHFPPMGRVMMPRPSMCHTSSLQIPKDKEQALRVSENELISLARSLLLAWNDPLLLLSSEAPTLPHPSNGDISSKIRELQDYSKSLGDGLDILVNKMGPSSQYISSIPFKGGDLGNDKTSRLINFHFLMSCFRRDSHKIDSFLKVLRCRATKMRPETC |
Position of mature hormone in Pre-Hormone protein | 187 Residues from position (24-210) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11002 |
Swiss-prot Accession number | P55752 (Sequence in FASTA format) |
Description | Prolactin-2 (Prolactin II) (PRL-II). |
Source organism | Alligator mississippiensis (American alligator) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Crocodylidae; Alligatorinae; Alligator. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 199 Amino acids |
Molecular weight | 22743 |
References | 1 PubMed abstract 1399264 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin-2 |
Mature Hormone Sequence | LPICPSGSVNCQVSLGELFDRAVKLSHYIHFLSSEMFNEFDERYAQGRGFITKAVNGCHTASLTTPEDKEQAQQIHHEDLLNLVLGVLRSWNDPLLHLVTEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRVQPGDTGNEVYSRWSGLPSLQLADEDSRLFAFYNLLHCGRRDSHKIDNYLKLLKCRLIHDSNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (1-199) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11003 |
Swiss-prot Accession number | P55754 (Sequence in FASTA format) |
Description | Prolactin-2 (Prolactin II) (PRL-II). |
Source organism | Crocodylus novaeguineae (Crocodile) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Crocodylidae; Crocodylinae; Crocodylus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 199 Amino acids |
Molecular weight | 22757 |
References | 1 PubMed abstract 1399264 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin-2 |
Mature Hormone Sequence | LPICPSGSVNCQVSLGELFDRAVKLSHYIHFLSSEMFNEFDERYAQGRGFITKAVNGCHTASLTTPEDKEQAQQIHHEDLLNLVLGVLRSWNDPLLHLVTEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIIGRVQPGDTGNEVYSRWSGLPSLQLADEDSRLFAFYNLLHCGRRDSHKIDNYLKLLKCRLIHDSNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (1-199) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11004 |
Swiss-prot Accession number | P09318 (Sequence in FASTA format) |
Description | Prolactin-2 precursor (Prolactin II) (PRL-177). |
Source organism | Oreochromis mossambicus (Mozambique tilapia) (Tilapia mossambica) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Labroidei;Cichlidae; African cichlids; Pseudocrenilabrinae; Tilapiini;Oreochromis. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 200 Amino acids |
Molecular weight | 22183 |
References | 1 PubMed abstract 2670495 2 PubMed abstract 3379064 3 PubMed abstract 3865172 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin-2 |
Mature Hormone Sequence | VPINDLIYRASQQSDKLHALSSMLTQELGSEAFPIDRVLACHTSSLQTPTDKEQALQVSESDLLSLARSLLQAWSDPLEVLSSSTNVLPYSAQSTLSKTIQKMQEHSKDLKDGLDILSSKMGPAAQTITSLPFIETNEIGQDKITKLLSCFRRDSHKIDSFLKVLRCRAANMQPQVC |
Position of mature hormone in Pre-Hormone protein | 177 Residues from position (24-200) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |