A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10415
Swiss-prot Accession number	P06884 (Sequence in FASTA format)
Description	Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Contains: Pancreatic hormone; Pancreatic icosapeptide] (Fragment).
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	66 Amino acids
Molecular weight	7483
References	1  PubMed abstract 3827854
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APLEPVYPGDNATPEQMAQYAAELRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10667
Swiss-prot Accession number	P06305 (Sequence in FASTA format)
Description	Pancreatic hormone (Pancreatic polypeptide) (PP).
Source organism	Alligator mississippiensis (American alligator)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Crocodylidae; Alligatorinae; Alligator.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	36 Amino acids
Molecular weight	4195
References	1  PubMed abstract 6745282 2  PubMed abstract 6146554
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	TPLQPKYPGDGAPVEDLIQFYDDLQQYLNVVTRPRF
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10668
Swiss-prot Accession number	P06304 (Sequence in FASTA format)
Description	Pancreatic hormone (Pancreatic polypeptide) (PP).
Source organism	Anser anser anser (Western graylag goose)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Anseriformes; Anatidae; Anser.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	36 Amino acids
Molecular weight	4391
References	1  PubMed abstract 6484562 2  PubMed abstract 6745282
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	GPSQPTYPGNDAPVEDLRFYYDNLQQYRLNVFRHRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10669
Swiss-prot Accession number	P01302 (Sequence in FASTA format)
Description	Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Contains: Pancreatic hormone; C-terminal peptide 1; C-terminalpeptide 2].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	131 Amino acids
Molecular weight	14376
References	1  PubMed abstract 7831336 2   Chance R.E., Moon N.E., Johnson M.G.; (In) Jaffe B.M., Behrman H.R. (eds.);Methods of hormone radioimmunoassay (2nd ed.), pp.657-672, AcademicPress, New York and London (1979). 3  PubMed abstract 1734969
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APLEPEYPGDNATPEQMAQYAAELRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (30-65)
Receptor	N/A
Gene ID	N/A
PDB ID	1BBA   1LJV   1V1D
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10670
Swiss-prot Accession number	P01299 (Sequence in FASTA format)
Description	Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Contains: Pancreatic hormone; Pancreatic icosapeptide].
Source organism	Canis familiaris (Dog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	93 Amino acids
Molecular weight	10427
References	1  PubMed abstract 3079195 2   Chance R.E., Moon N.E., Johnson M.G.; (In) Jaffe B.M., Behrman H.R. (eds.);Methods of hormone radioimmunoassay (2nd ed.), pp.657-672, AcademicPress, New York and London (1979). 3  PubMed abstract 7031480 4  PubMed abstract 3827854
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APLEPVYPGDDATPEQMAQYAAELRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (30-65)
Receptor	N/A
Gene ID	490944
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	10672
Swiss-prot Accession number	P13083 (Sequence in FASTA format)
Description	Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Contains: Pancreatic hormone; Pancreatic icosapeptide-like].
Source organism	Cavia porcellus (Guinea pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	126 Amino acids
Molecular weight	13489
References	1  PubMed abstract 2830269
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APLEPVYPGDDATPQQMAQYAAEMRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (27-62)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10673
Swiss-prot Accession number	P37999 (Sequence in FASTA format)
Description	Pancreatic hormone (Pancreatic polypeptide) (PP).
Source organism	Ceratotherium simum (White rhinoceros) (Square-lipped rhinoceros)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Rhinocerotidae;Ceratotherium.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	36 Amino acids
Molecular weight	4214
References	1  PubMed abstract 1808025
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	SPLEPVYPGDNATPEEMAQYAAELRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	10674
Swiss-prot Accession number	P41519 (Sequence in FASTA format)
Description	Pancreatic hormone (Pancreatic polypeptide) (PP).
Source organism	Chinchilla brevicaudata (Chinchilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	36 Amino acids
Molecular weight	4215
References	1  PubMed abstract 2235678
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APLEPVYPGDNATPEQMAQYAAEMRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	10675
Swiss-prot Accession number	P68248 (Sequence in FASTA format)
Description	Pancreatic hormone precursor (Pancreatic polypeptide) (PP).
Source organism	Gallus gallus (Chicken)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	80 Amino acids
Molecular weight	8773
References	1  PubMed abstract 8359685 2  PubMed abstract 1194289
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	GPSQPTYPGDDAPVEDLIRFYNDLQQYLNVVTRHRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (26-61)
Receptor	N/A
Gene ID	395564
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	10676
Swiss-prot Accession number	P18107 (Sequence in FASTA format)
Description	Pancreatic hormone (Pancreatic polypeptide) (PP).
Source organism	Didelphis marsupialis virginiana (North American opossum)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Didelphis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions.
Protein Length	36 Amino acids
Molecular weight	4238
References	1  PubMed abstract 2695899
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APQEPVYPGDDATPEQMAKYAAELRRYINRLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	10677
Swiss-prot Accession number	P68010 (Sequence in FASTA format)
Description	Pancreatic hormone (Pancreatic polypeptide) (PP).
Source organism	Equus caballus przewalskii (Przewalski's horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	36 Amino acids
Molecular weight	4215
References	1  PubMed abstract 1808025
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APMEPVYPGDNATPEQMAQYAAELRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	10678
Swiss-prot Accession number	P68009 (Sequence in FASTA format)
Description	Pancreatic hormone (Pancreatic polypeptide) (PP).
Source organism	Equus zebra (Mountain zebra)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	36 Amino acids
Molecular weight	4215
References	1  PubMed abstract 1808025
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APMEPVYPGDNATPEQMAQYAAELRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	10679
Swiss-prot Accession number	P41335 (Sequence in FASTA format)
Description	Pancreatic hormone (Pancreatic polypeptide) (PP).
Source organism	Erinaceus europaeus (Western European hedgehog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Insectivora; Erinaceidae;Erinaceinae; Erinaceus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	36 Amino acids
Molecular weight	4234
References	1  PubMed abstract 8234904
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	VPLEPVYPGDNATPEQMAHYAAELRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 14

HMRbase accession number	10681
Swiss-prot Accession number	P01298 (Sequence in FASTA format)
Description	Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Contains: Pancreatic hormone; Pancreatic icosapeptide].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	95 Amino acids
Molecular weight	10445
References	1  PubMed abstract 6373251 2  PubMed abstract 2997153 3  PubMed abstract 6094571 4  PubMed abstract 3753985 5  PubMed abstract 15489334 6  PubMed abstract 6366786 7  PubMed abstract 15966750
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (30-65)
Receptor	N/A
Gene ID	5539
PDB ID	1TZ4   1TZ5
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 15

HMRbase accession number	10683
Swiss-prot Accession number	P41337 (Sequence in FASTA format)
Description	Pancreatic hormone (Pancreatic polypeptide) (PP).
Source organism	Larus argentatus (Herring gull)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Charadriiformes; Laridae; Larus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	36 Amino acids
Molecular weight	4237
References	1  PubMed abstract 8174930
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	GPVQPTYPGDDAPVEDLVRFYNDLQQYLNVVTRHRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 16

HMRbase accession number	10684
Swiss-prot Accession number	P33684 (Sequence in FASTA format)
Description	Pancreatic hormone (Pancreatic polypeptide) (PP).
Source organism	Macaca mulatta (Rhesus macaque)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	36 Amino acids
Molecular weight	4183
References	1  PubMed abstract 2003150
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 17

HMRbase accession number	10685
Swiss-prot Accession number	P68249 (Sequence in FASTA format)
Description	Pancreatic hormone (Pancreatic polypeptide) (PP).
Source organism	Meleagris gallopavo (Common turkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Meleagris.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	36 Amino acids
Molecular weight	4239
References	1  PubMed abstract 913391 2  PubMed abstract 16593056 3  PubMed abstract 6673760
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	GPSQPTYPGDDAPVEDLIRFYNDLQQYLNVVTRHRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	1PPT   2BF9
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 18

HMRbase accession number	10686
Swiss-prot Accession number	P10601 (Sequence in FASTA format)
Description	Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Contains: Pancreatic hormone; C-terminal peptide].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	100 Amino acids
Molecular weight	11020
References	1  PubMed abstract 3343236
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APLEPMYPGDYATPEQMAQYETQLRRYINTLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (30-65)
Receptor	N/A
Gene ID	19064
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 19

HMRbase accession number	10687
Swiss-prot Accession number	P01300 (Sequence in FASTA format)
Description	Pancreatic hormone precursor (Pancreatic polypeptide) (PP) (Fragment).
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	65 Amino acids
Molecular weight	7290
References	1   Chance R.E., Johnson M.G., Hoffmann J.A., Lin T.-M.; (In) Baba S., Kaneko T., Yanaihara N. (eds.);Proinsulin, insulin, c-peptide, pp.419-425, Excerpta Medica, Amsterdam(1979). 2   Han X.G., Tuch B.E.; "Partial porcine pancreatic polypeptide cDNA sequence (3'end)."; Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases.
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APLEPVYPGDDATPEQMAQYAAELRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 20

HMRbase accession number	10689
Swiss-prot Accession number	P41336 (Sequence in FASTA format)
Description	Pancreatic hormone (Pancreatic polypeptide) (PP).
Source organism	Oryctolagus cuniculus (Rabbit)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	36 Amino acids
Molecular weight	4197
References	1  PubMed abstract 8299350
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APPEPVYPGDDATPEQMAEYVADLRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 21

HMRbase accession number	10690
Swiss-prot Accession number	P15427 (Sequence in FASTA format)
Description	Pancreatic hormone (Pancreatic polypeptide) (PP).
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	36 Amino acids
Molecular weight	4225
References	1  PubMed abstract 3260236
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APSEPHHPGDQATPDQLAQYYSDLYQYITFITRPRF
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 22

HMRbase accession number	10691
Swiss-prot Accession number	P31229 (Sequence in FASTA format)
Description	Pancreatic hormone (Pancreatic polypeptide) (PP).
Source organism	Rana temporaria (European common frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Rana.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	36 Amino acids
Molecular weight	4242
References	1  PubMed abstract 2091068
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APSEPHHPGDQATQDQLAQYYSDLYQYITFVTRPRF
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 23

HMRbase accession number	10692
Swiss-prot Accession number	P06303 (Sequence in FASTA format)
Description	Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Contains: Pancreatic hormone; C-terminal peptide].
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	98 Amino acids
Molecular weight	10975
References	1  PubMed abstract 3009446 2  PubMed abstract 3343236 3  PubMed abstract 3214179
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (30-65)
Receptor	N/A
Gene ID	24677
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 24

HMRbase accession number	10693
Swiss-prot Accession number	P01301 (Sequence in FASTA format)
Description	Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Contains: Pancreatic hormone; Pancreatic icosapeptide] (Fragment).
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	59 Amino acids
Molecular weight	6698
References	1   Chance R.E., Moon N.E., Johnson M.G.; (In) Jaffe B.M., Behrman H.R. (eds.);Methods of hormone radioimmunoassay (2nd ed.), pp.657-672, AcademicPress, New York and London (1979). 2  PubMed abstract 6723953
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	ASLEPEYPGDNATPEQMAQYAAELRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 25

HMRbase accession number	10695
Swiss-prot Accession number	P11967 (Sequence in FASTA format)
Description	Pancreatic hormone (Pancreatic polypeptide) (PP).
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	36 Amino acids
Molecular weight	4209
References	1  PubMed abstract 3623804
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	GPAQPTYPGDDAPVEDLVRFYDNLQQYLNVVTRHRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 26

HMRbase accession number	10696
Swiss-prot Accession number	P39659 (Sequence in FASTA format)
Description	Pancreatic hormone (Pancreatic polypeptide) (PP).
Source organism	Tapirus pinchaque (Mountain tapir)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Tapiridae;Tapirus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	36 Amino acids
Molecular weight	4197
References	1  PubMed abstract 1808025
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APLEPVYPGDNATPEQMAQYAAELRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated