![]() |
|
|
|
|
|
|
HMRbase accession number | 10441 |
Swiss-prot Accession number | P17219 (Sequence in FASTA format) |
Description | Prothoracicotropic hormone precursor (PTTH) [Contains: P2K; P6K;Prothoracicotropic hormone]. |
Source organism | Bombyx mori (Silk moth) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | N/A |
Tissue Specificity | PTTH is synthesized by two dorsolateral neurosecretory cells of the Bombyx brain |
Post translational modification | N/A |
Function | Peptides P2K and P6K are presumed to be cleaved post-translationally and may play some unknown physiologically or developmentally important functions |
Protein Length | 224 Amino acids |
Molecular weight | 26028 |
References | 1 PubMed abstract 2315701 2 PubMed abstract 8125124 3 PubMed abstract 1368675 4 PubMed abstract 8180220 |
Domain Name | N/A |
Hormone Name | P6K |
Mature Hormone Sequence | ARNDVLGDKENVRPNPYYTEPFDPDTSPEELSALIVDYANMIRNDVILLDNSVETRT |
Position of mature hormone in Pre-Hormone protein | 57 Residues from position (56-112) |
Receptor | N/A |
Gene ID | 692767 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |