A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11407 |
Swiss-prot Accession number | P13389 (Sequence in FASTA format) |
Description | Oxytocin-neurophysin 1 precursor (OT-NPI) [Contains: Oxytocin(Ocytocin); Neurophysin 1]. |
Source organism | Ovis aries (Sheep) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the vasopressin/oxytocin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Neurophysin 1 specifically binds oxytocin |
Protein Length | 125 Amino acids |
Molecular weight | 12635 |
References | 1 PubMed abstract 2798140 2 PubMed abstract 2095591 3 Acher R., Chauvet J., Lenci M.T.; "Purification and structure of sheep oxytocin and vasopressin."; C. R. Acad. Sci., D, Sci. Nat. 248:1435-1438(1959). |
Domain Name | Hormone_5 |
Hormone Name | Neurophysin 1 |
Mature Hormone Sequence | AVLDLDVRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCREENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCHADPACDPEAAFSQH |
Position of mature hormone in Pre-Hormone protein | 94 Residues from position (32-125) |
Receptor | Q28756
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11441 |
Swiss-prot Accession number | P35454 (Sequence in FASTA format) |
Description | Oxytocin-neurophysin 1 precursor (OT-NPI) [Contains: Oxytocin(Ocytocin); Neurophysin 1]. |
Source organism | Mus musculus (Mouse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the vasopressin/oxytocin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Neurophysin 1 specifically binds oxytocin |
Protein Length | 125 Amino acids |
Molecular weight | 12851 |
References | 1 PubMed abstract 2176709 2 PubMed abstract 11471062 |
Domain Name | Hormone_5 |
Hormone Name | Neurophysin 1 |
Mature Hormone Sequence | AVLDLDMRKCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAATGICCSPDGCRTDPACDPESAFSER |
Position of mature hormone in Pre-Hormone protein | 94 Residues from position (32-125) |
Receptor | P97926
Detail in HMRbase |
Gene ID | 18429 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |