![]() |
|
|
|
|
|
|
HMRbase accession number | 10128 |
Swiss-prot Accession number | Q27225 (Sequence in FASTA format) |
Description | Molt-inhibiting hormone precursor (MIH). |
Source organism | Carcinus maenas (Common shore crab) (Green crab) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Brachyura;Eubrachyura; Portunoidea; Portunidae; Carcinus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops |
Protein Length | 113 Amino acids |
Molecular weight | 13092 |
References | 1 PubMed abstract 8224217 2 PubMed abstract 1679945 |
Domain Name | Crust_neurohorm |
Hormone Name | Molt-inhibiting hormone |
Mature Hormone Sequence | RVINDECPNLIGNRDLYKKVEWICEDCSNIFRKTGMASLCRRNCFFNEDFVWCVHATERSEELRDLEEWVGILGAGRD |
Position of mature hormone in Pre-Hormone protein | 78 Residues from position (36-113) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10130 |
Swiss-prot Accession number | P83636 (Sequence in FASTA format) |
Description | Molt-inhibiting hormone precursor (MIH). |
Source organism | Orconectes limosus (Spinycheek crayfish) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Astacoidea; Cambaridae; Orconectes; Faxonius. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
Tissue Specificity | Sinus gland of the eyestalk |
Post translational modification | N/A |
Function | Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops |
Protein Length | 106 Amino acids |
Molecular weight | 12135 |
References | 1 PubMed abstract 16269348 |
Domain Name | Crust_neurohorm |
Hormone Name | Molt-inhibiting hormone |
Mature Hormone Sequence | RYVFEECPGVMGNRALHGKVTRVCEDCYNVFRDTDVLAGCRKGCFSSEMFKLCLLAMERVEEFPDFKRWIGILNA |
Position of mature hormone in Pre-Hormone protein | 75 Residues from position (30-104) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10131 |
Swiss-prot Accession number | Q10987 (Sequence in FASTA format) |
Description | Molt-inhibiting hormone precursor (MIH) (Fragment). |
Source organism | Procambarus bouvieri (Mexican crayfish) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Astacoidea; Cambaridae; Procambarus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops |
Protein Length | 74 Amino acids |
Molecular weight | 8530 |
References | 1 Aguilar-Gaytan R., Cerbon M.A., Cevallos M.A., Huberman A.; Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 8735961 |
Domain Name | Crust_neurohorm |
Hormone Name | Molt-inhibiting hormone |
Mature Hormone Sequence | QVFDQACKGIYDRAIFKKLELVCDDCYNLYRKPKVATTCRENCYANSVFRQCLDDLLLINVVDEYISGVQIV |
Position of mature hormone in Pre-Hormone protein | 72 Residues from position (1-72) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10402 |
Swiss-prot Accession number | O96605 (Sequence in FASTA format) |
Description | Molt-inhibiting hormone precursor (MIH). |
Source organism | Charybdis feriatus (Crab) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Brachyura;Eubrachyura; Portunoidea; Portunidae; Charybdis. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops |
Protein Length | 113 Amino acids |
Molecular weight | 13160 |
References | 1 PubMed abstract 9931416 |
Domain Name | Crust_neurohorm |
Hormone Name | Molt-inhibiting hormone |
Mature Hormone Sequence | RVFNDDCPNLMGNRDLYKKVEWICDDCANIFRIPGMASICRKDCFFNEDFLWCVRATERTEEMMQLKQWVRILGAGRM |
Position of mature hormone in Pre-Hormone protein | 78 Residues from position (36-113) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10469 |
Swiss-prot Accession number | P55846 (Sequence in FASTA format) |
Description | Molt-inhibiting hormone (MIH). |
Source organism | Cancer pagurus (Rock crab) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Brachyura;Eubrachyura; Cancroidea; Cancridae; Cancer. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops. Has also significant hyperglycemic hormone (CHH) activity |
Protein Length | 78 Amino acids |
Molecular weight | 9200 |
References | 1 PubMed abstract 8868306 |
Domain Name | Crust_neurohorm |
Hormone Name | Molt-inhibiting hormone |
Mature Hormone Sequence | RVINDDCPNLIGNRDLYKKVEWICEDCSNIFRNTGMATLCRKNCFFNEDFLWCVYATERTEEMSQLRQWVGILGAGRE |
Position of mature hormone in Pre-Hormone protein | 78 Residues from position (1-78) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10647 |
Swiss-prot Accession number | P55321 (Sequence in FASTA format) |
Description | Molt-inhibiting hormone precursor (MIH). |
Source organism | Callinectes sapidus (Blue crab) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Brachyura;Eubrachyura; Portunoidea; Portunidae; Callinectes. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops |
Protein Length | 113 Amino acids |
Molecular weight | 12850 |
References | 1 PubMed abstract 7537497 |
Domain Name | Crust_neurohorm |
Hormone Name | Molt-inhibiting hormone |
Mature Hormone Sequence | RVINDDCPNLIGNRDLYKKVEWICDDCANIYRSTGMASLCRKDCFFNEDFLWCVRATERSEDLAQLKQWVTILGAGRI |
Position of mature hormone in Pre-Hormone protein | 78 Residues from position (36-113) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10648 |
Swiss-prot Accession number | O61389 (Sequence in FASTA format) |
Description | Molt-inhibiting hormone precursor (MIH). |
Source organism | Cancer magister (Dungeness crab) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Brachyura;Eubrachyura; Cancroidea; Cancridae; Cancer. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops |
Protein Length | 113 Amino acids |
Molecular weight | 13228 |
References | 1 PubMed abstract 9548218 |
Domain Name | Crust_neurohorm |
Hormone Name | Molt-inhibiting hormone |
Mature Hormone Sequence | RVINDDCPNLIGNRDLYKRVEWICEDCSNIFRNTGMATLCRKNCFFNEDFLWCVYATERTEEMSQLRQWVGILGAGRE |
Position of mature hormone in Pre-Hormone protein | 78 Residues from position (36-113) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10650 |
Swiss-prot Accession number | P55847 (Sequence in FASTA format) |
Description | Molt-inhibiting hormone precursor (MIH) (PeJ-SGP-IV). |
Source organism | Penaeus japonicus (Kuruma prawn) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Marsupenaeus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where it is stored and released |
Post translational modification | N/A |
Function | Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops. Has little or no hyperglycemic activity |
Protein Length | 105 Amino acids |
Molecular weight | 12150 |
References | 1 PubMed abstract 9450390 2 PubMed abstract 8801521 |
Domain Name | Crust_neurohorm |
Hormone Name | Molt-inhibiting hormone |
Mature Hormone Sequence | SFIDNTCRGVMGNRDIYKKVVRVCEDCTNIFRLPGLDGMCRNRCFYNEWFLICLKAANREDEIEKFRVWISILNAGQ |
Position of mature hormone in Pre-Hormone protein | 77 Residues from position (29-105) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | 1J0T |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10652 |
Swiss-prot Accession number | P55848 (Sequence in FASTA format) |
Description | Molt-inhibiting hormone (MIH). |
Source organism | Procambarus clarkii (Red swamp crayfish) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Astacoidea; Cambaridae; Procambarus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops |
Protein Length | 75 Amino acids |
Molecular weight | 8658 |
References | 1 PubMed abstract 8901124 |
Domain Name | Crust_neurohorm |
Hormone Name | Molt-inhibiting hormone |
Mature Hormone Sequence | RYVFEECPGVMGNRAVHGKVTRVCEDCYNVFRDTDVLAGCRKGCFSSEMFKLCLLAMERVEEFPDFKRWIGILNA |
Position of mature hormone in Pre-Hormone protein | 75 Residues from position (1-75) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |