![]() |
|
|
|
|
|
|
HMRbase accession number | 10015 |
Swiss-prot Accession number | Q9PUR1 (Sequence in FASTA format) |
Description | Glucagon-1 precursor [Contains: Glucagon-1 (Glucagon I); Glucagon-likepeptide 1-I (GLP-1I); Glucagon-like peptide 2-I (GLP-2I)]. |
Source organism | Petromyzon marinus (Sea lamprey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 160 Amino acids |
Molecular weight | 18042 |
References | 1 PubMed abstract 10555286 2 PubMed abstract 8405897 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-1 |
Mature Hormone Sequence | HSEGTFTSDYSKYLENKQAKDFVRWLMNA |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (43-71) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10246 |
Swiss-prot Accession number | Q91971 (Sequence in FASTA format) |
Description | Glucagon-1 precursor (Glucagon I) [Contains: Glicentin-relatedpolypeptide 1 (GRPP 1); Glucagon-1; Glucagon-like peptide 1-1 (GLP 1-1); Glucagon-like peptide 2 (GLP 2)]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 178 Amino acids |
Molecular weight | 20034 |
References | 1 PubMed abstract 7776976 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-1 |
Mature Hormone Sequence | HSEGTFSNDYSKYQEERMAQDFVQWLMNS |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (52-80) |
Receptor | N/A |
Gene ID | 100136745 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10248 |
Swiss-prot Accession number | P81026 (Sequence in FASTA format) |
Description | Glucagon-1 (Glucagon I). |
Source organism | Oreochromis niloticus (Nile tilapia) (Tilapia nilotica) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Labroidei;Cichlidae; African cichlids; Pseudocrenilabrinae; Tilapiini;Oreochromis. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 36 Amino acids |
Molecular weight | 4252 |
References | 1 PubMed abstract 7656183 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-1 |
Mature Hormone Sequence | HSEGTFSNDYSKYLEDRKAQDFVRWLMNNKRSGAAE |
Position of mature hormone in Pre-Hormone protein | 36 Residues from position (1-36) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11069 |
Swiss-prot Accession number | P01278 (Sequence in FASTA format) |
Description | Glucagon-1 precursor (Glucagon I) [Contains: Glicentin-relatedpolypeptide (GRPP); Glucagon-1 (Glucagon I); Glucagon-like peptide 1(Glucagon-like peptide I)]. |
Source organism | Lophius americanus (American goosefish) (Anglerfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Paracanthopterygii; Lophiiformes; Lophiidae; Lophius. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. |
Protein Length | 124 Amino acids |
Molecular weight | 14165 |
References | 1 PubMed abstract 7043459 2 PubMed abstract 6165720 3 PubMed abstract 3058456 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-1 |
Mature Hormone Sequence | HSEGTFSNDYSKYLEDRKAQEFVRWLMNN |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (53-81) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11071 |
Swiss-prot Accession number | P07449 (Sequence in FASTA format) |
Description | Glucagon-1 precursor [Contains: Glucagon-1; Glucagon-like peptide 1-1](Fragment). |
Source organism | Oncorhynchus kisutch (Coho salmon) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 68 Amino acids |
Molecular weight | 7819 |
References | 1 PubMed abstract 3520699 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-1 |
Mature Hormone Sequence | HSEGTFSNDYSKYQEERMAQDFVQWLMNS |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (1-29) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |