![]() |
|
|
|
|
|
|
HMRbase accession number | 10018 |
Swiss-prot Accession number | P05110 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)]. |
Source organism | Cavia porcellus (Guinea pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity). |
Function | Glicentin may modulate gastric acid secretion and gastro-pyloro-duodenal activity |
Protein Length | 180 Amino acids |
Molecular weight | 20972 |
References | 1 PubMed abstract 3755107 2 PubMed abstract 3956884 3 PubMed abstract 4048553 4 PubMed abstract 12554744 5 PubMed abstract 12626323 6 PubMed abstract 10322410 7 PubMed abstract 10605628 |
Domain Name | Hormone_2 |
Hormone Name | Glicentin |
Mature Hormone Sequence | RSLQDTEEKPRSVSASQTDMLDDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQQFLKWLLNVKRNRNNIA |
Position of mature hormone in Pre-Hormone protein | 69 Residues from position (21-89) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10406 |
Swiss-prot Accession number | P01273 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)]. |
Source organism | Mesocricetus auratus (Golden hamster) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Cricetidae; Cricetinae; Mesocricetus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity). |
Function | Glicentin may modulate gastric acid secretion and gastro-pyloro-duodenal activity |
Protein Length | 180 Amino acids |
Molecular weight | 20954 |
References | 1 PubMed abstract 6835407 2 Bell G.I.; Submitted (JUN-1985) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 12554744 4 PubMed abstract 12626323 5 PubMed abstract 10322410 6 PubMed abstract 10605628 |
Domain Name | Hormone_2 |
Hormone Name | Glicentin |
Mature Hormone Sequence | HSLQDTEEKSRSFPASQTDPLEDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA |
Position of mature hormone in Pre-Hormone protein | 69 Residues from position (21-89) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11079 |
Swiss-prot Accession number | P01272 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)]. |
Source organism | Bos taurus (Bovine) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract |
Post translational modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity). |
Function | Glicentin may modulate gastric acid secretion and gastro-pyloro-duodenal activity |
Protein Length | 180 Amino acids |
Molecular weight | 20944 |
References | 1 PubMed abstract 6577439 2 Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 5102927 4 PubMed abstract 12554744 5 PubMed abstract 12626323 6 PubMed abstract 10322410 7 PubMed abstract 10605628 8 PubMed abstract 6631957 |
Domain Name | Hormone_2 |
Hormone Name | Glicentin |
Mature Hormone Sequence | RSLQNTEEKSSSFPAPQTDPLGDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
Position of mature hormone in Pre-Hormone protein | 69 Residues from position (21-89) |
Receptor | N/A |
Gene ID | 280802 |
PDB ID | 1KX6 |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11084 |
Swiss-prot Accession number | P29794 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)]. |
Source organism | Canis familiaris (Dog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain |
Post translational modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity). |
Function | Glicentin may modulate gastric acid secretion and gastro-pyloro-duodenal activity |
Protein Length | 180 Amino acids |
Molecular weight | 21115 |
References | 1 PubMed abstract 11916259 2 PubMed abstract 3238052 3 PubMed abstract 10499540 4 PubMed abstract 12554744 5 PubMed abstract 12626323 6 PubMed abstract 10322410 7 PubMed abstract 10605628 |
Domain Name | Hormone_2 |
Hormone Name | Glicentin |
Mature Hormone Sequence | RSLQDTEEKSRSFSAPQTEPLNDLDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
Position of mature hormone in Pre-Hormone protein | 69 Residues from position (21-89) |
Receptor | N/A |
Gene ID | 403571 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11107 |
Swiss-prot Accession number | P22890 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)]. |
Source organism | Octodon degus (Degu) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Octodontidae; Octodon. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain |
Post translational modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity). |
Function | Glicentin may modulate gastric acid secretion and gastro-pyloro-duodenal activity |
Protein Length | 180 Amino acids |
Molecular weight | 21166 |
References | 1 PubMed abstract 2293024 2 PubMed abstract 12554744 3 PubMed abstract 12626323 4 PubMed abstract 10322410 5 PubMed abstract 10605628 |
Domain Name | Hormone_2 |
Hormone Name | Glicentin |
Mature Hormone Sequence | HPLQDTEEKPRSFSTSQTDLLDDPDQMNEDKRHSQGTFTSDYSKFLDTRRAQDFLDWLKNTKRNRNEIA |
Position of mature hormone in Pre-Hormone protein | 69 Residues from position (21-89) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11112 |
Swiss-prot Accession number | P01274 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)]. |
Source organism | Sus scrofa (Pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain |
Post translational modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity). |
Function | Glicentin may modulate gastric acid secretion and gastro-pyloro-duodenal activity |
Protein Length | 180 Amino acids |
Molecular weight | 21029 |
References | 1 Siggers R.H., Goldade B.G., Laarveld B., Van Kessel A.G.; "Cloning of porcine proglucagon."; Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 6894800 3 PubMed abstract 7045833 4 Bromer W.W., Sinn L.G., Behrens O.K.; "The amino acid sequence of glucagon. V. Location of amide groups,acid degradation studies and summary of sequential evidence."; J. Am. Chem. Soc. 79:2807-2810(1957). 5 PubMed abstract 2753890 6 PubMed abstract 3379036 7 PubMed abstract 3530719 8 PubMed abstract 12554744 9 PubMed abstract 12626323 10 PubMed abstract 10322410 11 PubMed abstract 10605628 12 PubMed abstract 171582 |
Domain Name | Hormone_2 |
Hormone Name | Glicentin |
Mature Hormone Sequence | RSLQNTEEKSRSFPAPQTDPLDDPDQMTEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
Position of mature hormone in Pre-Hormone protein | 69 Residues from position (21-89) |
Receptor | N/A |
Gene ID | 397595 |
PDB ID | 1GCN |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11127 |
Swiss-prot Accession number | Q8MJ25 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)](Fragment). |
Source organism | Ovis aries (Sheep) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain |
Post translational modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity). |
Function | Glicentin may modulate gastric acid secretion and gastro-pyloro-duodenal activity |
Protein Length | 176 Amino acids |
Molecular weight | 20336 |
References | 1 Limesand S.W., Hay W.W. Jr.; "Characterization of the endocrine pancreas in an ovine placentalinsufficiency IUGR fetus."; Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Hormone_2 |
Hormone Name | Glicentin |
Mature Hormone Sequence | HSLQNTEEKSSSFPAPQTDPLGDPDQISEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
Position of mature hormone in Pre-Hormone protein | 69 Residues from position (21-89) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11329 |
Swiss-prot Accession number | P01275 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)]. |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain |
Post translational modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas. |
Function | Glicentin may modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life |
Protein Length | 180 Amino acids |
Molecular weight | 20909 |
References | 1 PubMed abstract 2901414 2 PubMed abstract 3725587 3 PubMed abstract 6877358 4 Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,Phelan M., Farmer A.; "Cloning of human full-length CDSs in BD Creator(TM) system donorvector."; Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases. 5 PubMed abstract 15815621 6 PubMed abstract 15489334 7 PubMed abstract 11946536 8 PubMed abstract 2753890 9 PubMed abstract 8482423 10 PubMed abstract 14557443 11 PubMed abstract 14632334 12 PubMed abstract 9287128 13 PubMed abstract 12651102 14 PubMed abstract 14719035 15 PubMed abstract 12554744 16 PubMed abstract 12626323 17 PubMed abstract 10322410 18 PubMed abstract 10605628 19 PubMed abstract 9667960 20 PubMed abstract 11943215 21 PubMed abstract 12627948 |
Domain Name | Hormone_2 |
Hormone Name | Glicentin |
Mature Hormone Sequence | RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA |
Position of mature hormone in Pre-Hormone protein | 69 Residues from position (21-89) |
Receptor | P47871
Detail in HMRbase |
Gene ID | 2641 |
PDB ID | 1BH0 1D0R 1NAU |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11380 |
Swiss-prot Accession number | P06883 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)]. |
Source organism | Rattus norvegicus (Rat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract |
Post translational modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas. |
Function | Glicentin may modulate gastric acid secretion and the gastro-pyloro-duodenal activity |
Protein Length | 180 Amino acids |
Molecular weight | 20846 |
References | 1 PubMed abstract 6094539 2 PubMed abstract 6548696 3 PubMed abstract 3528148 4 PubMed abstract 7937770 5 PubMed abstract 11564680 6 PubMed abstract 8721980 7 PubMed abstract 1692320 8 PubMed abstract 14719035 9 PubMed abstract 12554744 10 PubMed abstract 12626323 11 PubMed abstract 10322410 12 PubMed abstract 10605628 |
Domain Name | Hormone_2 |
Hormone Name | Glicentin |
Mature Hormone Sequence | HAPQDTEENARSFPASQTEPLEDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA |
Position of mature hormone in Pre-Hormone protein | 69 Residues from position (21-89) |
Receptor | P30082
Detail in HMRbase |
Gene ID | 24952 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11476 |
Swiss-prot Accession number | P55095 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)]. |
Source organism | Mus musculus (Mouse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain |
Post translational modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity). |
Function | Glicentin may modulate gastric acid secretion and gastro-pyloro-duodenal activity |
Protein Length | 180 Amino acids |
Molecular weight | 20906 |
References | 1 PubMed abstract 7730317 2 Shamsadin R., Knepel W.; "Mouse glucagon full length cDNA."; Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 16141072 4 PubMed abstract 15489334 5 PubMed abstract 1886889 6 PubMed abstract 9407057 7 PubMed abstract 11356850 8 PubMed abstract 12554744 9 PubMed abstract 12626323 10 PubMed abstract 10322410 11 PubMed abstract 10605628 |
Domain Name | Hormone_2 |
Hormone Name | Glicentin |
Mature Hormone Sequence | HALQDTEENPRSFPASQTEAHEDPDEMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA |
Position of mature hormone in Pre-Hormone protein | 69 Residues from position (21-89) |
Receptor | Q61606 Detail in HMRbase Q3UN81 Detail in HMRbase |
Gene ID | 14526 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |