![]() |
|
|
|
|
|
|
HMRbase accession number | 11197 |
Swiss-prot Accession number | P09681 (Sequence in FASTA format) |
Description | Gastric inhibitory polypeptide precursor (GIP) (Glucose-dependentinsulinotropic polypeptide). |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Potent stimulator of insulin secretion and relatively poor inhibitor of gastric acid secretion |
Protein Length | 153 Amino acids |
Molecular weight | 17108 |
References | 1 PubMed abstract 2890159 2 PubMed abstract 2739653 3 PubMed abstract 15489334 4 PubMed abstract 6745415 5 PubMed abstract 15522230 |
Domain Name | Hormone_2 |
Hormone Name | Gastric inhibitory polypeptide |
Mature Hormone Sequence | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
Position of mature hormone in Pre-Hormone protein | 42 Residues from position (52-93) |
Receptor | N/A |
Gene ID | 2695 |
PDB ID | 1T5Q 2B4N |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |