A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10096
Swiss-prot Accession number	P83485 (Sequence in FASTA format)
Description	Crustacean hyperglycemic hormone A (CHHA).
Source organism	Cherax destructor (Yabbie)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Parastacoidea; Parastacidae; Cherax.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the arthropod CHH/MIH/GIH/VIH hormone family.
Tissue Specificity	N/A
Post translational modification	Stereoinversion of L-Phe (in CHHA-I) to D-Phe (in CHHA-II).
Function	Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction
Protein Length	72 Amino acids
Molecular weight	8375
References	1  PubMed abstract 15127939
Domain Name	Crust_neurohorm
Hormone Name	Crustacean hyperglycemic hormone A
Mature Hormone Sequence	QVFDQACKGVYDRAIFKKLDRVCDDCYNLYRKPYVAVSCRGNCYNNLVFRQCLEELFLGNGFNEYISGVQTV
Position of mature hormone in Pre-Hormone protein	72 Residues from position (1-72)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10580
Swiss-prot Accession number	P19806 (Sequence in FASTA format)
Description	Crustacean hyperglycemic hormones isoform A precursor [Contains: CHHprecursor-related peptide A (CPRP-A); Crustacean hyperglycemic hormoneA (CHH-A) (Molt-inhibiting hormone) (MIH)].
Source organism	Homarus americanus (American lobster)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Nephropoidea; Nephropidae; Homarus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the arthropod CHH/MIH/GIH/VIH hormone family.
Tissue Specificity	Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released. Present also in the ventral nervous system
Post translational modification	Stereoinversion of L-Phe (form CHH-A-I) to D-Phe (form CHH-A- II).
Function	CHH is the most abundant hormone in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone. MIH may inhibit Y-organs where molting hormone (ecdysteroid) is secreted and a molting cycle is initiated when MIH secretion diminishes or stops
Protein Length	134 Amino acids
Molecular weight	14996
References	1  PubMed abstract 7999796 2  PubMed abstract 1879416 3  PubMed abstract 2169734 4  PubMed abstract 2384751 5  PubMed abstract 8034574
Domain Name	Crust_neurohorm
Hormone Name	Crustacean hyperglycemic hormone A
Mature Hormone Sequence	QVFDQACKGVYDRNLFKKLDRVCEDCYNLYRKPFVATTCRENCYSNWVFRQCLDDLLLSDVIDEYVSNVQMV
Position of mature hormone in Pre-Hormone protein	72 Residues from position (61-132)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated