![]() |
|
|
|
|
|
|
HMRbase accession number | 10094 |
Swiss-prot Accession number | Q9U5D2 (Sequence in FASTA format) |
Description | Crustacean hyperglycemic hormones 2 precursor (Pej-SGP-II) [Contains:CHH precursor-related peptide 2 (CPRP 2); Crustacean hyperglycemichormone 2 (CHH 2)]. |
Source organism | Penaeus japonicus (Kuruma prawn) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Marsupenaeus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
Protein Length | 120 Amino acids |
Molecular weight | 13467 |
References | 1 Ohira T., Watanabe T., Aida K., Nagasawa H.; "Crustacean hyperglycemic hormone of kuruma prawn Penaeus japonicus."; Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 9210164 |
Domain Name | Crust_neurohorm |
Hormone Name | Crustacean hyperglycemic hormone 2 |
Mature Hormone Sequence | SLFDPSCTGVFDRQLLRRLGRVCDDCFNVFREPNVAMECRSNCYNNPVFRQCMEYLLPAHLHDEYRLAVQMV |
Position of mature hormone in Pre-Hormone protein | 72 Residues from position (47-118) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10573 |
Swiss-prot Accession number | O97384 (Sequence in FASTA format) |
Description | Crustacean hyperglycemic hormones 2 precursor (Pm-SGP-II) [Contains:CHH precursor-related peptide 2 (CPRP 2); Crustacean hyperglycemichormone 2 (CHH 2)]. |
Source organism | Penaeus monodon (Penoeid shrimp) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Penaeus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
Protein Length | 118 Amino acids |
Molecular weight | 13137 |
References | 1 PubMed abstract 10804243 2 Chen H.-Y., Cheng J.-H., Huang C.-J.; "Molecular cloning and sequence analysis of cDNAs encoding crustaceanhyperglycemic hormone-like neuropeptides from the tiger prawn Penaeusmonodon."; Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases. |
Domain Name | Crust_neurohorm |
Hormone Name | Crustacean hyperglycemic hormone 2 |
Mature Hormone Sequence | ANFDPSCAGVYNRELLGRLSRLCDDCYNVFREPKVATECRSNCFYNPVFVQCLEYLIPADLHEEYQAHVQTV |
Position of mature hormone in Pre-Hormone protein | 72 Residues from position (45-116) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |