A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10008
Swiss-prot Accession number	Q9PU41 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 70(CCK70); Cholecystokinin 8 (CCK8); Cholecystokinin 7 (CCK7)].
Source organism	Gallus gallus (Chicken)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	In the small intestine, the major production site is around the vitelline diverticulum
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. It also decreases food intake and regulates gastrointestinal physiological processes.
Protein Length	130 Amino acids
Molecular weight	14091
References	1  PubMed abstract 11072120 2  PubMed abstract 3620999 3  PubMed abstract 8355559 4  PubMed abstract 8637413 5  PubMed abstract 9039026 6  PubMed abstract 10069039
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	QQPAGSHDGSPVAAELQQSLTEPHRHSRAPSSAGPLKPAPRLDGSFEQRATIGALLAKYLQQARKGSTGRFSVLGNRVQSIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
Position of mature hormone in Pre-Hormone protein	110 Residues from position (21-130)
Receptor	Q7T1P8    Detail in HMRbase
Gene ID	414884
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 2

HMRbase accession number	10430
Swiss-prot Accession number	P0C229 (Sequence in FASTA format)
Description	Cholecystokinin (CCK).
Source organism	Macropus giganteus (Eastern gray kangaroo)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Diprotodontia; Macropodidae; Macropus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	8 Amino acids
Molecular weight	1064
References	1  PubMed abstract 8134294
Domain Name	N/A
Hormone Name	Cholecystokinin
Mature Hormone Sequence	DYMGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (1-8)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10487
Swiss-prot Accession number	P68125 (Sequence in FASTA format)
Description	Cholecystokinin (CCK).
Source organism	Dasyurus viverrinus (Southeastern quoll)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Dasyurus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	8 Amino acids
Molecular weight	1064
References	1  PubMed abstract 3375140
Domain Name	N/A
Hormone Name	Cholecystokinin
Mature Hormone Sequence	DYMGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (1-8)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10488
Swiss-prot Accession number	P68126 (Sequence in FASTA format)
Description	Cholecystokinin (CCK).
Source organism	Macropus eugenii (Tammar wallaby)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Diprotodontia; Macropodidae; Macropus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	8 Amino acids
Molecular weight	1064
References	1  PubMed abstract 3375140
Domain Name	N/A
Hormone Name	Cholecystokinin
Mature Hormone Sequence	DYMGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (1-8)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10776
Swiss-prot Accession number	O57340 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Gallus gallus (Chicken)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	134 Amino acids
Molecular weight	15065
References	1  PubMed abstract 9245526
Domain Name	Cys_knot
Hormone Name	Cholecystokinin
Mature Hormone Sequence	HPISSQHLDEGQRSISTPSEALLEADTHSLGEPHLRQSRSAPQLKSLPVAEEDGDSRANLSELLARLISSRKGSVRRNSTAYSKGLSPNHRIADRDYLGWMDFGRRSAEEYEYSS
Position of mature hormone in Pre-Hormone protein	115 Residues from position (21-135)
Receptor	N/A
Gene ID	395937
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	11163
Swiss-prot Accession number	O93464 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK8) [Contains: Cholecystokinin 8 (CCK8);Cholecystokinin 12 (CCK12); Cholecystokinin 26 (CCK26);Cholecystokinin 36 (CCK36); Cholecystokinin 69 (CCK69)].
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted (Potential)
Developmental Stage	Expression in the brain shows variation throughout the seasonal sexual cycle; in the optic tectum-thalamus of females, expression levels are lower in early gonadal recrudescence (October) compared to other sexual stages. In males, expression is high in the olfactory bulbs in early gonadal recrudescence and low in the posterior brain in late gonadal recrudescence (January). Expression is higher in females than males in the telencephalon-preoptic region and posterior brain during late gonadal recrudescence, and in the olfactory bulbs and optic tectum-thalamus during the sexually mature (April), and post-spawning and sexually regressed (July) stages.
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in the ovary, kidney, gill, gastrointestinal tract and pituitary. Differentially expressed in the brain in the optic tectum-thalamus, hypothalamus, telencephalon, olfactory bulb and tract, preoptic region and posterior brain region. Expression is strongest in the hypothalamus, where localization is to the posterior ventrolateral region. Expression in the brain is transiently increased 2 hours after feeding. Abundant in the sensory layers of the vagal lobe and along the border of the sensory region of the lobe and the deep fiber laye. Also present in the facial lobe and throughout the glossopharyngeal lobe
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins (By similarity).
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut (By similarity). Induces the secretion of gonadotropin and growth hormone from the pituitary. Suppresses food intake and decreases the expression of preprosomatostatin genes in the forebrain
Protein Length	123 Amino acids
Molecular weight	13439
References	1  PubMed abstract 9493851 2  PubMed abstract 8262360 3  PubMed abstract 8092330 4  PubMed abstract 10640690 5  PubMed abstract 12124755 6  PubMed abstract 14751584 7  PubMed abstract 15256279
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	LSLPAVSEDGGQSDLGIVMEHTRHTRAAPSSGQLSLLSKAEDDEEPRSSLTELLARIISTKGTYRRSPSPKSKSMGNNHRIKDRDYLGWMDFGRRSAEEYEYSS
Position of mature hormone in Pre-Hormone protein	104 Residues from position (20-123)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	11170
Swiss-prot Accession number	P23362 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12665
References	1  PubMed abstract 2174979 2   "DNA sequences of macaque genes expressed in brain or testis and itsevolutionary implications."; Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	QPVPPAEPAGSGLQRAEEAPRRQLRAVQRTDGESRAHLGALLARYIQQARKAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Position of mature hormone in Pre-Hormone protein	95 Residues from position (21-115)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	11181
Swiss-prot Accession number	O57312 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 8 (CCK8)].
Source organism	Paralichthys olivaceus (Japanese flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Paralichthyidae; Paralichthys.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins (By similarity).
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	135 Amino acids
Molecular weight	14773
References	1  PubMed abstract 11042006
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	HPISSQHLDEGQRSISTPSEALLEADTHSLGEPHLRQSRSAPQLKSLPVAEEDGDSRANLSELLARLISSRKGSVRRNSTAYSKGLSPNHRIADRDYLGWMDFGRRSAEEYEYSS
Position of mature hormone in Pre-Hormone protein	115 Residues from position (21-135)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	11183
Swiss-prot Accession number	P01356 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Synthesized in both cerebral cortex and duodenal mucosa
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins. Brain contains CCK-octapeptide (CCK8) and several CCK-desoctapeptides; whereas pig gut contains intact CCK33, CCK39, and CCK58 as well as CCK-octapeptide and the CCK- desoctapeptides. Distribution differences are due to tissue- specific post-translational processing events.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.
Protein Length	114 Amino acids
Molecular weight	12526
References	1  PubMed abstract 6205394 2   Mutt V., Jorpes J.E.; Submitted (AUG-1970) to the PIR data bank. 3  PubMed abstract 5410106 4  PubMed abstract 8443599
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	QPVPPADSAVPGAQEEEAHRRQLRAVQKVDGESRAHLGALLARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEYEYTS
Position of mature hormone in Pre-Hormone protein	94 Residues from position (21-114)
Receptor	N/A
Gene ID	397468
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	11189
Swiss-prot Accession number	P80344 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 33 (CCK33); Cholecystokinin 8 (CCK8);Cholecystokinin 7 (CCK7)].
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in brain, lung, testis and throughout the length of the small intestine. In the brain, expressed predominantly in the optic tectum and brain stem
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	130 Amino acids
Molecular weight	14449
References	1  PubMed abstract 9075736 2  PubMed abstract 7925386
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	QQTVGSMNEDPGAREIEQQNILQHPRHIRASSSAQLKPFQRIDGTSDQKAVIGAMLAKYLQTRKAGSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
Position of mature hormone in Pre-Hormone protein	110 Residues from position (21-130)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	11194
Swiss-prot Accession number	Q9PU29 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 70(CCK70); Cholecystokinin 8 (CCK8); Cholecystokinin 7 (CCK7)].
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Highly concentrated in the duodenum. Also localized in more distal parts of the small intestine
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	130 Amino acids
Molecular weight	14273
References	1  PubMed abstract 11072120
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	QQTAGSHNGNPLAAELEQSLTEHHRHVRAPSSAGPLKPVPRLDGSIDQRANIGALLAKYLQQARKGPTGRISVMGNRVQSIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
Position of mature hormone in Pre-Hormone protein	110 Residues from position (21-130)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	11195
Swiss-prot Accession number	P80345 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 40 (CCK40); Cholecystokinin 33 (CCK33);Cholecystokinin 8 (CCK8); Cholecystokinin 7 (CCK7)].
Source organism	Trachemys scripta (Red-eared slider turtle) (Pseudemys scripta)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Testudines; Cryptodira; Testudinoidea; Emydidae; Trachemys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Expressed in brain, duodenum and small intestine
Post translational modification	N/A
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	130 Amino acids
Molecular weight	14603
References	1  PubMed abstract 10561540 2  PubMed abstract 7925386
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	QQATGSHNENPVATELEQSLTEHHRHVRVPSSAGQLKPIQRLDGNVDQKANIGALLAKYLQQARKGPTGRISMMGNRVQNIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
Position of mature hormone in Pre-Hormone protein	110 Residues from position (21-130)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	11354
Swiss-prot Accession number	P01355 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 39(CCK39); Cholecystokinin 33 (CCK33); Cholecystokinin 22 (CCK22);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	The shortest form (CCK8) is predominantly found in the brain, whereas the larger ones are found in the intestine
Post translational modification	Cholecystokinin, also known as CCK58, is proteolytically cleaved to produce a number of active cholecystokinins. Sulfation of Tyr-97 is essential for receptor activation.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12841
References	1  PubMed abstract 2981840 2  PubMed abstract 6199787 3  PubMed abstract 3861130 4  PubMed abstract 6209267 5  PubMed abstract 12479974 6   Varro A., Young J., Gregory H., Csech J., Dockray G.J.; "Isolation, structure and properties of the C-terminal fragment of therat cholecystokinin precursor."; Regul. Pept. 15:195-195(1986). 7  PubMed abstract 8208365
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	AVLRPDSEPRARLGALLARYIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	58 Residues from position (46-103)
Receptor	P30553   Detail in HMRbase    P30551    Detail in HMRbase
Gene ID	25298
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 14

HMRbase accession number	11372
Swiss-prot Accession number	P06307 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12669
References	1  PubMed abstract 3856870 2   Kato K., Takahashi Y., Matsubara K.; "Molecular cloning of the human cholecystokinin gene."; Ann. N. Y. Acad. Sci. 448:613-615(1985). 3   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,Phelan M., Farmer A.; "Cloning of human full-length CDSs in BD Creator(TM) system donorvector."; Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases. 4   Livingston R.J., Rieder M.J., Chung M.-W., Ritchie T.K., Olson A.N.,Nguyen C.P., Nguyen D.A., Poel C.L., Robertson P.D., Schackwitz W.S.,Sherwood J.K., Sherwood A.M., Leithauser B.J., Nickerson D.A.; "NIEHS-SNPs, environmental genome project, NIEHS ES15478, Departmentof Genome Sciences, Seattle, WA (URL: http://egp.gs.washington.edu)."; Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases. 5  PubMed abstract 15489334 6  PubMed abstract 11076522
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	QPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Position of mature hormone in Pre-Hormone protein	95 Residues from position (21-115)
Receptor	P32239   Detail in HMRbase    P32238    Detail in HMRbase
Gene ID	885
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 15

HMRbase accession number	11390
Swiss-prot Accession number	P09240 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 33(CCK33); Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12866
References	1  PubMed abstract 2011497 2  PubMed abstract 3862083
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	QPVVPAEATDPVEQRAEEAPRRQLRAVLRPDREPRARLGALLARYIQQVRKAPSGRMSVLKNLQSLDPSHRISDRDYMGWMDFGRRSAEDYEYPS
Position of mature hormone in Pre-Hormone protein	95 Residues from position (21-115)
Receptor	P56481   Detail in HMRbase    O08786   Detail in HMRbase    Q3TPL0   Detail in HMRbase    Q3ZB46   Detail in HMRbase    Q3ZB53   Detail in HMRbase    Q8BKF6    Detail in HMRbase
Gene ID	12424
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 16

HMRbase accession number	11445
Swiss-prot Accession number	P41520 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12835
References	1   Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2217909 3  PubMed abstract 4011954
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	QPMPHADPTGPRAQQAEEAPRRQLRAVPRVDDEPRAQLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEFEYTS
Position of mature hormone in Pre-Hormone protein	95 Residues from position (21-115)
Receptor	P79266    Detail in HMRbase
Gene ID	617510
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 17

HMRbase accession number	11471
Swiss-prot Accession number	P50144 (Sequence in FASTA format)
Description	Cholecystokinin type 1 precursor [Contains: Cholecystokinin (CCK)].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Brain, gastrointestinal tract and lung
Post translational modification	N/A
Function	N/A
Protein Length	123 Amino acids
Molecular weight	13943
References	1  PubMed abstract 7669225
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	DYMGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (104-111)
Receptor	P70031    Detail in HMRbase
Gene ID	378611
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 18

HMRbase accession number	11472
Swiss-prot Accession number	P50145 (Sequence in FASTA format)
Description	Cholecystokinin type 2 precursor [Contains: Cholecystokinin (CCK)].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Brain and gastrointestinal tract
Post translational modification	N/A
Function	N/A
Protein Length	128 Amino acids
Molecular weight	14201
References	1  PubMed abstract 7669225
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	DYMGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (109-116)
Receptor	P70031    Detail in HMRbase
Gene ID	378612
PDB ID	N/A
Drugpedia	wiki
Comments