![]() |
|
|
|
|
|
|
HMRbase accession number | 10297 |
Swiss-prot Accession number | P04563 (Sequence in FASTA format) |
Description | Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin]. |
Source organism | Rattus norvegicus (Rat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
Protein Length | 104 Amino acids |
Molecular weight | 11832 |
References | 1 PubMed abstract 3453895 2 PubMed abstract 6897117 3 PubMed abstract 1701434 |
Domain Name | Gastrin |
Hormone Name | Big gastrin |
Mature Hormone Sequence | QLGPQGPQHFIADLSKKQRPPMEEEEEAYGWMDF |
Position of mature hormone in Pre-Hormone protein | 34 Residues from position (59-92) |
Receptor | P30553
Detail in HMRbase |
Gene ID | 25320 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10410 |
Swiss-prot Accession number | P04564 (Sequence in FASTA format) |
Description | Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin]. |
Source organism | Capra hircus (Goat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Capra. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
Protein Length | 34 Amino acids |
Molecular weight | 3903 |
References | 1 PubMed abstract 3763441 |
Domain Name | N/A |
Hormone Name | Big gastrin |
Mature Hormone Sequence | QLGLQDPPHMVADLSKKQGPWVEEEEAAYGWMDF |
Position of mature hormone in Pre-Hormone protein | 34 Residues from position (1-34) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10413 |
Swiss-prot Accession number | P06885 (Sequence in FASTA format) |
Description | Gastrin precursor [Contains: Big gastrin (Gastrin 33) (G33); Gastrin]. |
Source organism | Cavia porcellus (Guinea pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
Protein Length | 33 Amino acids |
Molecular weight | 3757 |
References | 1 PubMed abstract 3747718 |
Domain Name | N/A |
Hormone Name | Big gastrin |
Mature Hormone Sequence | QLGPQVPAHLRTDLSKKQGPWAEEEAAYGWMDF |
Position of mature hormone in Pre-Hormone protein | 33 Residues from position (1-33) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10427 |
Swiss-prot Accession number | P0C228 (Sequence in FASTA format) |
Description | Gastrin precursor [Contains: Big gastrin (Gastrin-33); Gastrin-16;Gastrin-15]. |
Source organism | Macropus giganteus (Eastern gray kangaroo) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Diprotodontia; Macropodidae; Macropus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
Protein Length | 33 Amino acids |
Molecular weight | 3913 |
References | 1 PubMed abstract 8134294 |
Domain Name | N/A |
Hormone Name | Big gastrin |
Mature Hormone Sequence | QLHPQDLPHLMTDLSKKKGPWQEEDAAYGWMDF |
Position of mature hormone in Pre-Hormone protein | 33 Residues from position (1-33) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10431 |
Swiss-prot Accession number | P10034 (Sequence in FASTA format) |
Description | Gastrin precursor [Contains: Big gastrin (Gastrin 33) (G33); Gastrin]. |
Source organism | Chinchilla brevicaudata (Chinchilla) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
Protein Length | 33 Amino acids |
Molecular weight | 3715 |
References | 1 PubMed abstract 3827930 |
Domain Name | N/A |
Hormone Name | Big gastrin |
Mature Hormone Sequence | ELEPQGPPHLGTDLSKKQGPWAEEEAAYGWMDF |
Position of mature hormone in Pre-Hormone protein | 33 Residues from position (1-33) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10454 |
Swiss-prot Accession number | P33713 (Sequence in FASTA format) |
Description | Gastrin precursor [Contains: Big gastrin (Gastrin 33) (G33); Gastrin]. |
Source organism | Didelphis marsupialis virginiana (North American opossum) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Didelphis. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
Protein Length | 33 Amino acids |
Molecular weight | 3856 |
References | 1 PubMed abstract 2361360 |
Domain Name | N/A |
Hormone Name | Big gastrin |
Mature Hormone Sequence | QLGPQDLPYLTADLSKKQGPWLEEEEAYGWMDF |
Position of mature hormone in Pre-Hormone protein | 33 Residues from position (1-33) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11148 |
Swiss-prot Accession number | P01354 (Sequence in FASTA format) |
Description | Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin]. |
Source organism | Felis silvestris catus (Cat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
Protein Length | 104 Amino acids |
Molecular weight | 11482 |
References | 1 PubMed abstract 1773057 2 PubMed abstract 5784957 |
Domain Name | Gastrin |
Hormone Name | Big gastrin |
Mature Hormone Sequence | QLGLQGPPQQVADLSKKQGPWLEEEEAAYGWMDF |
Position of mature hormone in Pre-Hormone protein | 34 Residues from position (59-92) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11150 |
Swiss-prot Accession number | P55885 (Sequence in FASTA format) |
Description | Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin]. |
Source organism | Equus caballus (Horse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
Protein Length | 107 Amino acids |
Molecular weight | 11884 |
References | 1 PubMed abstract 9716385 |
Domain Name | Gastrin |
Hormone Name | Big gastrin |
Mature Hormone Sequence | QLGLQGSPHLVADLSKKQGPWLEKEEAAYGWMDF |
Position of mature hormone in Pre-Hormone protein | 34 Residues from position (62-95) |
Receptor | N/A |
Gene ID | 100034214 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11152 |
Swiss-prot Accession number | P01351 (Sequence in FASTA format) |
Description | Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin]. |
Source organism | Sus scrofa (Pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
Protein Length | 104 Amino acids |
Molecular weight | 11558 |
References | 1 PubMed abstract 6951161 2 PubMed abstract 6930858 3 PubMed abstract 14248711 4 PubMed abstract 14248712 |
Domain Name | Gastrin |
Hormone Name | Big gastrin |
Mature Hormone Sequence | QLGLQGPPHLVADLAKKQGPWMEEEEEAYGWMDF |
Position of mature hormone in Pre-Hormone protein | 34 Residues from position (59-92) |
Receptor | N/A |
Gene ID | 445524 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11154 |
Swiss-prot Accession number | O02686 (Sequence in FASTA format) |
Description | Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin]. |
Source organism | Ovis aries (Sheep) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
Protein Length | 104 Amino acids |
Molecular weight | 11532 |
References | 1 PubMed abstract 9522119 2 PubMed abstract 5665711 |
Domain Name | Gastrin |
Hormone Name | Big gastrin |
Mature Hormone Sequence | QLGLQDPPHMVADLSKKQGPWVEEEEAAYGWM |
Position of mature hormone in Pre-Hormone protein | Residues from position 34 |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11346 |
Swiss-prot Accession number | P01350 (Sequence in FASTA format) |
Description | Gastrin precursor [Contains: Gastrin-71 (Component I); Gastrin-52(G52); Big gastrin (Gastrin-34) (G34) (Component II); Gastrin(Gastrin-17) (G17) (Component III); Gastrin-14 (G14); Gastrin-6 (G6)]. |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | Two different processing pathways probably exist in antral G- cells. In the dominant pathway progastrin is cleaved at three sites resulting in two major bioactive gastrins, gastrin-34 and gastrin-17. In the putative alternative pathway, progastrin may be processed only at the most C-terminal dibasic site resulting in the synthesis of gastrin-71. Sulfation of Tyr-87 blocks peptide degradation and enhances activity. |
Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
Protein Length | 101 Amino acids |
Molecular weight | 11394 |
References | 1 PubMed abstract 3034736 2 PubMed abstract 6087340 3 PubMed abstract 6324077 4 PubMed abstract 6574456 5 PubMed abstract 6322186 6 PubMed abstract 6689486 7 PubMed abstract 15489334 8 PubMed abstract 8055952 9 PubMed abstract 5921183 10 PubMed abstract 2730647 11 PubMed abstract 5822140 12 PubMed abstract 7530658 13 PubMed abstract 11052986 |
Domain Name | Gastrin |
Hormone Name | Big gastrin |
Mature Hormone Sequence | QLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF |
Position of mature hormone in Pre-Hormone protein | 34 Residues from position (59-92) |
Receptor | P32239
Detail in HMRbase |
Gene ID | 2520 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11350 |
Swiss-prot Accession number | P01352 (Sequence in FASTA format) |
Description | Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin]. |
Source organism | Bos taurus (Bovine) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
Protein Length | 104 Amino acids |
Molecular weight | 11573 |
References | 1 PubMed abstract 2608050 2 PubMed abstract 1773057 3 PubMed abstract 5665711 |
Domain Name | Gastrin |
Hormone Name | Big gastrin |
Mature Hormone Sequence | QLGLQDPPHMVADLSKKQGPWVEEEEAAYGWMDF |
Position of mature hormone in Pre-Hormone protein | 34 Residues from position (59-92) |
Receptor | P79266
Detail in HMRbase |
Gene ID | 280800 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11352 |
Swiss-prot Accession number | P01353 (Sequence in FASTA format) |
Description | Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin]. |
Source organism | Canis familiaris (Dog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
Protein Length | 104 Amino acids |
Molecular weight | 11519 |
References | 1 PubMed abstract 2262079 2 PubMed abstract 3763441 3 PubMed abstract 5799207 4 PubMed abstract 2756156 |
Domain Name | Gastrin |
Hormone Name | Big gastrin |
Mature Hormone Sequence | QLGLQGPPQLVADLSKKQGPWMEEEEAAYGWMDF |
Position of mature hormone in Pre-Hormone protein | 34 Residues from position (59-92) |
Receptor | P30552
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11464 |
Swiss-prot Accession number | P48757 (Sequence in FASTA format) |
Description | Gastrin precursor [Contains: Gastrin-71 (G71); Big gastrin (Gastrin-34) (G34); Gastrin]. |
Source organism | Mus musculus (Mouse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
Protein Length | 101 Amino acids |
Molecular weight | 11607 |
References | 1 PubMed abstract 7488110 2 PubMed abstract 7492958 3 PubMed abstract 8647266 |
Domain Name | Gastrin |
Hormone Name | Big gastrin |
Mature Hormone Sequence | GSASHHRRQLGLQGPQHFIADLSKKERPRMEEEEEAYGWMDF |
Position of mature hormone in Pre-Hormone protein | 34 Residues from position (59-92) |
Receptor | P56481 Detail in HMRbase Q8BKF6 Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |