![]() |
|
|
|
|
|
|
HMRbase accession number | 10067 |
Swiss-prot Accession number | Q8I7X1 (Sequence in FASTA format) |
Description | Androgenic gland hormone precursor (Pos-AGH) [Contains: Androgenicgland hormone B chain; Androgenic gland hormone A chain]. |
Source organism | Porcellio scaber (Common slater) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Peracarida; Isopoda; Oniscidea; Porcellionidae;Porcellio. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | N/A |
Tissue Specificity | Androgenic gland |
Post translational modification | N/A |
Function | Controls sex differentiation and the formation of male appendages, spermatogenesis, pigmentation, and male specific behavior |
Protein Length | 145 Amino acids |
Molecular weight | 16973 |
References | 1 PubMed abstract 15081839 2 PubMed abstract 12560604 |
Domain Name | N/A |
Hormone Name | Androgenic gland hormone A chain |
Mature Hormone Sequence | DIAFHEECCNIRTEHKCNKTTVELYCRRYTR |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (115-145) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10082 |
Swiss-prot Accession number | Q9U8R2 (Sequence in FASTA format) |
Description | Androgenic gland hormone precursor (Arv-AGH) [Contains: Androgenicgland hormone B chain; Androgenic gland hormone A chain]. |
Source organism | Armadillidium vulgare (Woodlice) (Pillbugs) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Peracarida; Isopoda; Oniscidea; Armadillidiidae;Armadillidium. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | N/A |
Tissue Specificity | Androgenic gland |
Post translational modification | N/A |
Function | Controls sex differentiation and the formation of male appendages, spermatogenesis, pigmentation, and male specific behavior |
Protein Length | 144 Amino acids |
Molecular weight | 16893 |
References | 1 PubMed abstract 10529379 2 PubMed abstract 10411634 |
Domain Name | N/A |
Hormone Name | Androgenic gland hormone A chain |
Mature Hormone Sequence | EIAFYQECCNIRTEHKCNRTTVSLYCRTY |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (116-144) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10512 |
Swiss-prot Accession number | Q86SA8 (Sequence in FASTA format) |
Description | Androgenic gland hormone precursor (Pod-AGH) [Contains: Androgenicgland hormone B chain; Androgenic gland hormone A chain]. |
Source organism | Porcellio dilatatus |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Peracarida; Isopoda; Oniscidea; Porcellionidae;Porcellio. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | N/A |
Tissue Specificity | Androgenic gland |
Post translational modification | N/A |
Function | Controls sex differentiation and the formation of male appendages, spermatogenesis, pigmentation, and male specific behavior |
Protein Length | 146 Amino acids |
Molecular weight | 17425 |
References | 1 PubMed abstract 12560604 |
Domain Name | N/A |
Hormone Name | Androgenic gland hormone A chain |
Mature Hormone Sequence | DIAFHEECCNIRTEHKCNRTTVELYCRRYSP |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (116-146) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |