![]() |
|
|
|
|
|
|
HMRbase accession number | 10034 |
Swiss-prot Accession number | Q9TRM8 (Sequence in FASTA format) |
Description | Prorelaxin precursor [Contains: Relaxin B chain; Relaxin A chain]. |
Source organism | Canis familiaris (Dog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | Placenta; syncytiotrophoblast |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals |
Protein Length | 177 Amino acids |
Molecular weight | 20563 |
References | 1 PubMed abstract 10026098 2 PubMed abstract 1388669 |
Domain Name | Insulin |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | TDDKKLKACGRDYVRLQIEVCGSIWWGRKAGQLRE |
Position of mature hormone in Pre-Hormone protein | 35 Residues from position (26-60) |
Receptor | Q5XM32
Detail in HMRbase |
Gene ID | 403742 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10366 |
Swiss-prot Accession number | Q9TRM8 (Sequence in FASTA format) |
Description | Prorelaxin precursor [Contains: Relaxin B chain; Relaxin A chain]. |
Source organism | Canis familiaris (Dog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | Placenta; syncytiotrophoblast |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals |
Protein Length | 177 Amino acids |
Molecular weight | 20563 |
References | 1 PubMed abstract 10026098 2 PubMed abstract 1388669 |
Domain Name | Insulin |
Hormone Name | Relaxin A chain |
Mature Hormone Sequence | DNYIKMSDKCCNVGCTRRELASRC |
Position of mature hormone in Pre-Hormone protein | 24 Residues from position (154-177) |
Receptor | Q5XM32
Detail in HMRbase |
Gene ID | 403742 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |