A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10343 |
Swiss-prot Accession number | Q925Q5 (Sequence in FASTA format) |
Description | Glycoprotein hormone alpha-2 precursor (Thyrostimulin subunit alpha). |
Source organism | Mus musculus (Mouse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
Subcellular location | Secreted protein (By similarity) |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Stimulates the thyroid. Binds and activates THSR, leads to increased cAMP production |
Protein Length | 128 Amino acids |
Molecular weight | 14030 |
References | 1 Ching A., Gilbert T., Sheppard P., Webster P., O'Hara P.J.; "A novel cysteine knot protein expressed in pancreatic acinar cells."; Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 15489334 |
Domain Name | N/A |
Hormone Name | Glycoprotein hormone alpha-2 |
Mature Hormone Sequence | HSPETAIPGCHLHPFNVTVRSDRLGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSSSQCCTISSLRKVRVWLQCVGNQRGELEIFTARACQCDMCRFSRY |
Position of mature hormone in Pre-Hormone protein | 108 Residues from position (21-128) |
Receptor | P47750
Detail in HMRbase |
Gene ID | 170458 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |