A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10309 |
| Swiss-prot Accession number | Q04617 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC A)[Contains: NPP 1; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 1 (Alpha-MSH 1); Corticotropin-like intermediarypeptide 1 (CLIP-1); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 1 (Beta-MSH 1); Beta-endorphin 1; Met-enkephalin]. |
| Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular location | Secreted |
| Developmental Stage | Expressed in sexually active or inactive fish. |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | Pituitary and hypothalamus of adult diploid animals, and hypothalamus of triploid and ovulated female trout |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
| Function | N/A |
| Protein Length | 253 Amino acids |
| Molecular weight | 28559 |
| References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Corticotropin |
| Mature Hormone Sequence | SYSMEHFRWGKPVGRKRRPVKVYTNGVEEESSEAFPSEM |
| Position of mature hormone in Pre-Hormone protein | 39 Residues from position (104-142) |
| Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
| Gene ID | 100136771 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |
| HMRbase accession number | 10310 |
| Swiss-prot Accession number | Q04617 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC A)[Contains: NPP 1; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 1 (Alpha-MSH 1); Corticotropin-like intermediarypeptide 1 (CLIP-1); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 1 (Beta-MSH 1); Beta-endorphin 1; Met-enkephalin]. |
| Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular location | Secreted |
| Developmental Stage | Expressed in sexually active or inactive fish. |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | Pituitary and hypothalamus of adult diploid animals, and hypothalamus of triploid and ovulated female trout |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
| Function | N/A |
| Protein Length | 253 Amino acids |
| Molecular weight | 28559 |
| References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Melanotropin alpha 1 |
| Mature Hormone Sequence | SYSMEHFRWGKPV |
| Position of mature hormone in Pre-Hormone protein | 13 Residues from position (104-116) |
| Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
| Gene ID | 100136771 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |
| HMRbase accession number | 10311 |
| Swiss-prot Accession number | Q04617 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC A)[Contains: NPP 1; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 1 (Alpha-MSH 1); Corticotropin-like intermediarypeptide 1 (CLIP-1); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 1 (Beta-MSH 1); Beta-endorphin 1; Met-enkephalin]. |
| Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular location | Secreted |
| Developmental Stage | Expressed in sexually active or inactive fish. |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | Pituitary and hypothalamus of adult diploid animals, and hypothalamus of triploid and ovulated female trout |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
| Function | N/A |
| Protein Length | 253 Amino acids |
| Molecular weight | 28559 |
| References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Lipotropin beta (Beta-LPH) |
| Mature Hormone Sequence | ELGTDDAVYPSLEAGTAEGGEAEGMEGVFSLQEKKDGSYKMNHFRWSGPPASKRYGGFMKSWDERSQKPLLTLFKNVIIKDGQQ |
| Position of mature hormone in Pre-Hormone protein | 84 Residues from position (145-228) |
| Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
| Gene ID | 100136771 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |
| HMRbase accession number | 10312 |
| Swiss-prot Accession number | Q04617 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC A)[Contains: NPP 1; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 1 (Alpha-MSH 1); Corticotropin-like intermediarypeptide 1 (CLIP-1); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 1 (Beta-MSH 1); Beta-endorphin 1; Met-enkephalin]. |
| Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular location | Secreted |
| Developmental Stage | Expressed in sexually active or inactive fish. |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | Pituitary and hypothalamus of adult diploid animals, and hypothalamus of triploid and ovulated female trout |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
| Function | N/A |
| Protein Length | 253 Amino acids |
| Molecular weight | 28559 |
| References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Melanotropin beta 1 |
| Mature Hormone Sequence | DGSYKMNHFRWSGPPAS |
| Position of mature hormone in Pre-Hormone protein | 17 Residues from position (180-196) |
| Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
| Gene ID | 100136771 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |
| HMRbase accession number | 10313 |
| Swiss-prot Accession number | Q04617 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC A)[Contains: NPP 1; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 1 (Alpha-MSH 1); Corticotropin-like intermediarypeptide 1 (CLIP-1); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 1 (Beta-MSH 1); Beta-endorphin 1; Met-enkephalin]. |
| Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular location | Secreted |
| Developmental Stage | Expressed in sexually active or inactive fish. |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | Pituitary and hypothalamus of adult diploid animals, and hypothalamus of triploid and ovulated female trout |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
| Function | N/A |
| Protein Length | 253 Amino acids |
| Molecular weight | 28559 |
| References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Beta-endorphin 1 |
| Mature Hormone Sequence | YGGFMKSWDERSQKPLLTLFKNVIIKDGQQ |
| Position of mature hormone in Pre-Hormone protein | 30 Residues from position (199-228) |
| Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
| Gene ID | 100136771 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |
| HMRbase accession number | 10314 |
| Swiss-prot Accession number | Q04617 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC A)[Contains: NPP 1; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 1 (Alpha-MSH 1); Corticotropin-like intermediarypeptide 1 (CLIP-1); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 1 (Beta-MSH 1); Beta-endorphin 1; Met-enkephalin]. |
| Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular location | Secreted |
| Developmental Stage | Expressed in sexually active or inactive fish. |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | Pituitary and hypothalamus of adult diploid animals, and hypothalamus of triploid and ovulated female trout |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
| Function | N/A |
| Protein Length | 253 Amino acids |
| Molecular weight | 28559 |
| References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Met-enkephalin |
| Mature Hormone Sequence | YGGFM |
| Position of mature hormone in Pre-Hormone protein | 5 Residues from position (199-203) |
| Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
| Gene ID | 100136771 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |
| HMRbase accession number | 11500 |
| Swiss-prot Accession number | Q04617 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC A)[Contains: NPP 1; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 1 (Alpha-MSH 1); Corticotropin-like intermediarypeptide 1 (CLIP-1); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 1 (Beta-MSH 1); Beta-endorphin 1; Met-enkephalin]. |
| Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular location | Secreted |
| Developmental Stage | Expressed in sexually active or inactive fish. |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | Pituitary and hypothalamus of adult diploid animals, and hypothalamus of triploid and ovulated female trout |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
| Function | N/A |
| Protein Length | 253 Amino acids |
| Molecular weight | 28559 |
| References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Lipotropin gamma (Gamma-LPH) |
| Mature Hormone Sequence | ELGTDDAVYPSLEAGTAEGGEAEGMEGVFSLQEKKDGSYKMNHFRWSGPPAS |
| Position of mature hormone in Pre-Hormone protein | 52 Residues from position (145-196) |
| Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
| Gene ID | 100136771 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |