A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10305 |
Swiss-prot Accession number | P81277 (Sequence in FASTA format) |
Description | Prolactin-releasing peptide precursor (PrRP) (Prolactin-releasinghormone) [Contains: Prolactin-releasing peptide PrRP31; Prolactin-releasing peptide PrRP20]. |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | N/A |
Tissue Specificity | Medulla oblongata and hypothalamus |
Post translational modification | N/A |
Function | Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL |
Protein Length | 87 Amino acids |
Molecular weight | 9639 |
References | 1 PubMed abstract 9607765 2 PubMed abstract 15489334 3 PubMed abstract 10498338 |
Domain Name | N/A |
Hormone Name | Prolactin-releasing peptide PrRP31 |
Mature Hormone Sequence | SRTHRHSMEIRTPDINPAWYASRGIRPVGRF |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (23-53) |
Receptor | P49683
Detail in HMRbase |
Gene ID | 51052 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10306 |
Swiss-prot Accession number | P81277 (Sequence in FASTA format) |
Description | Prolactin-releasing peptide precursor (PrRP) (Prolactin-releasinghormone) [Contains: Prolactin-releasing peptide PrRP31; Prolactin-releasing peptide PrRP20]. |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | N/A |
Tissue Specificity | Medulla oblongata and hypothalamus |
Post translational modification | N/A |
Function | Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL |
Protein Length | 87 Amino acids |
Molecular weight | 9639 |
References | 1 PubMed abstract 9607765 2 PubMed abstract 15489334 3 PubMed abstract 10498338 |
Domain Name | N/A |
Hormone Name | Prolactin-releasing peptide PrRP20 |
Mature Hormone Sequence | TPDINPAWYASRGIRPVGRF |
Position of mature hormone in Pre-Hormone protein | 20 Residues from position (34-53) |
Receptor | P49683
Detail in HMRbase |
Gene ID | 51052 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |