A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10303 |
Swiss-prot Accession number | P81264 (Sequence in FASTA format) |
Description | Prolactin-releasing peptide precursor (PrRP) (Prolactin-releasinghormone) [Contains: Prolactin-releasing peptide PrRP31; Prolactin-releasing peptide PrRP20]. |
Source organism | Bos taurus (Bovine) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | N/A |
Tissue Specificity | Medulla oblongata and hypothalamus |
Post translational modification | N/A |
Function | Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL |
Protein Length | 98 Amino acids |
Molecular weight | 10544 |
References | 1 PubMed abstract 9607765 |
Domain Name | N/A |
Hormone Name | Prolactin-releasing peptide PrRP31 |
Mature Hormone Sequence | SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (23-53) |
Receptor | Q4EW11
Detail in HMRbase |
Gene ID | 286856 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10304 |
Swiss-prot Accession number | P81264 (Sequence in FASTA format) |
Description | Prolactin-releasing peptide precursor (PrRP) (Prolactin-releasinghormone) [Contains: Prolactin-releasing peptide PrRP31; Prolactin-releasing peptide PrRP20]. |
Source organism | Bos taurus (Bovine) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | N/A |
Tissue Specificity | Medulla oblongata and hypothalamus |
Post translational modification | N/A |
Function | Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL |
Protein Length | 98 Amino acids |
Molecular weight | 10544 |
References | 1 PubMed abstract 9607765 |
Domain Name | N/A |
Hormone Name | Prolactin-releasing peptide PrRP20 |
Mature Hormone Sequence | RTPDINPAWYAGRGIRPVGRF |
Position of mature hormone in Pre-Hormone protein | 21 Residues from position (33-53) |
Receptor | Q4EW11
Detail in HMRbase |
Gene ID | 286856 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |