A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11498 |
Swiss-prot Accession number | P79695 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glicentin-related polypeptide (GRPP);Glucagon; Glucagon-like peptide]. |
Source organism | Carassius auratus (Goldfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis |
Protein Length | 121 Amino acids |
Molecular weight | 13527 |
References | 1 DOI=10.1023/A:1007793705131; Yuen T.T.H., Mok P.Y., Chow B.K.C.; "Molecular cloning of a cDNA encoding proglucagon from goldfish,Carassius auratus."; Fish Physiol. Biochem. 17:223-230(1997).
|
Domain Name | Hormone_2 |
Hormone Name | Glucagon |
Mature Hormone Sequence | HSEGTFSNDYSKYLETRRAQDFVEWLMNS |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (50-78) |
Receptor | Q5EFJ9
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11499 |
Swiss-prot Accession number | P79695 (Sequence in FASTA format) |
Description | Glucagon precursor [Contains: Glicentin-related polypeptide (GRPP);Glucagon; Glucagon-like peptide]. |
Source organism | Carassius auratus (Goldfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 121 Amino acids |
Molecular weight | 13527 |
References | 1 DOI=10.1023/A:1007793705131; Yuen T.T.H., Mok P.Y., Chow B.K.C.; "Molecular cloning of a cDNA encoding proglucagon from goldfish,Carassius auratus."; Fish Physiol. Biochem. 17:223-230(1997).
|
Domain Name | Hormone_2 |
Hormone Name | Glucagon-like peptide |
Mature Hormone Sequence | HAEGTYTSDISSFLRDQAAQNFVAWLKSGQPKQE |
Position of mature hormone in Pre-Hormone protein | 34 Residues from position (88-121) |
Receptor | Q5EFJ9
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |