![]() |
|
|
|
|
|
|
HMRbase accession number | 10300 |
Swiss-prot Accession number | P52212 (Sequence in FASTA format) |
Description | Parathyroid hormone precursor (Parathyrin) (PTH). |
Source organism | Canis familiaris (Dog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the parathyroid hormone family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion |
Protein Length | 115 Amino acids |
Molecular weight | 12957 |
References | 1 PubMed abstract 7642102 |
Domain Name | Parathyroid |
Hormone Name | Parathyroid hormone (Parathyrin) (PTH) |
Mature Hormone Sequence | SVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNFVALGAPIAHRDGSSQRPLKKEDNVLVESYQKSLGEADKADVDVLTKAKSQ |
Position of mature hormone in Pre-Hormone protein | 84 Residues from position (32-115) |
Receptor | Q9TU31
Detail in HMRbase |
Gene ID | 403986 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |