A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10032 |
Swiss-prot Accession number | P47932 (Sequence in FASTA format) |
Description | Prorelaxin 1 precursor [Contains: Relaxin B chain; Relaxin A chain]. |
Source organism | Mus musculus (Mouse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals |
Protein Length | 185 Amino acids |
Molecular weight | 20571 |
References | 1 PubMed abstract 8452637 2 PubMed abstract 8216305 |
Domain Name | Insulin |
Hormone Name | Relaxin B chain |
Mature Hormone Sequence | RVSEEWMDGFIRMCGREYARELIKICGASVGRLAL |
Position of mature hormone in Pre-Hormone protein | 35 Residues from position (23-57) |
Receptor | Q91ZZ5
Detail in HMRbase |
Gene ID | 19773 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11462 |
Swiss-prot Accession number | P47932 (Sequence in FASTA format) |
Description | Prorelaxin 1 precursor [Contains: Relaxin B chain; Relaxin A chain]. |
Source organism | Mus musculus (Mouse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals |
Protein Length | 185 Amino acids |
Molecular weight | 20571 |
References | 1 PubMed abstract 8452637 2 PubMed abstract 8216305 |
Domain Name | Insulin |
Hormone Name | Relaxin A chain |
Mature Hormone Sequence | ESGGLMSQQCCHVGCSRRSIAKLYC |
Position of mature hormone in Pre-Hormone protein | 25 Residues from position (161-185) |
Receptor | Q91ZZ5
Detail in HMRbase |
Gene ID | 19773 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |