A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11427 |
Swiss-prot Accession number | P21819 (Sequence in FASTA format) |
Description | Diuretic hormone 1 precursor (DH-1) (Diuretic peptide 1) (DP-1) (Mas-DH). |
Source organism | Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Sphingoidea;Sphingidae; Sphinginae; Manduca. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Regulation of fluid secretion |
Protein Length | 138 Amino acids |
Molecular weight | 15297 |
References | 1 PubMed abstract 1279702 2 PubMed abstract 16594029 |
Domain Name | CRF |
Hormone Name | Diuretic hormone 1 |
Mature Hormone Sequence | RMPSLSIDLPMSVLRQKLSLEKERKVHALRAAANRNFLNDI |
Position of mature hormone in Pre-Hormone protein | 41 Residues from position (81-121) |
Receptor | P35464
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |