![]() |
|
|
|
|
|
|
HMRbase accession number | 11413 |
Swiss-prot Accession number | P17572 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Meleagris gallopavo (Common turkey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Meleagris. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | Three forms are found, non-glycosylated, glycosylated and one form seems to be only O-glycosylated. |
Function | N/A |
Protein Length | 229 Amino acids |
Molecular weight | 25854 |
References | 1 PubMed abstract 8618952 2 PubMed abstract 1879669 3 PubMed abstract 2349117 4 PubMed abstract 1769204 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICSSGSVNCQVSLGELFDRAVRLSHYIHFLSSEIFNEFDERYAQGRGFITKAVNGCHTSSLTTPEDKEQTQQIHHEELLNLILGVLRSWNDPLIHLASEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRIHSGDAGNEVFSQWDGLPSLQLADEDSRLFAFYNLLHCLRRDSHKIDNYLKVLKCRLIHDNNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (31-229) |
Receptor | Q91094
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |