A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	11406
Swiss-prot Accession number	P13389 (Sequence in FASTA format)
Description	Oxytocin-neurophysin 1 precursor (OT-NPI) [Contains: Oxytocin(Ocytocin); Neurophysin 1].
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the vasopressin/oxytocin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland
Protein Length	125 Amino acids
Molecular weight	12635
References	1  PubMed abstract 2798140 2  PubMed abstract 2095591 3   Acher R., Chauvet J., Lenci M.T.; "Purification and structure of sheep oxytocin and vasopressin."; C. R. Acad. Sci., D, Sci. Nat. 248:1435-1438(1959).
Domain Name	Hormone_5
Hormone Name	Oxytocin
Mature Hormone Sequence	CYIQNCPLG
Position of mature hormone in Pre-Hormone protein	9 Residues from position (20-28)
Receptor	Q28756    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 2

HMRbase accession number	11407
Swiss-prot Accession number	P13389 (Sequence in FASTA format)
Description	Oxytocin-neurophysin 1 precursor (OT-NPI) [Contains: Oxytocin(Ocytocin); Neurophysin 1].
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the vasopressin/oxytocin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Neurophysin 1 specifically binds oxytocin
Protein Length	125 Amino acids
Molecular weight	12635
References	1  PubMed abstract 2798140 2  PubMed abstract 2095591 3   Acher R., Chauvet J., Lenci M.T.; "Purification and structure of sheep oxytocin and vasopressin."; C. R. Acad. Sci., D, Sci. Nat. 248:1435-1438(1959).
Domain Name	Hormone_5
Hormone Name	Neurophysin 1
Mature Hormone Sequence	AVLDLDVRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCREENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCHADPACDPEAAFSQH
Position of mature hormone in Pre-Hormone protein	94 Residues from position (32-125)
Receptor	Q28756    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments