A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 11404 |
Swiss-prot Accession number | P12707 (Sequence in FASTA format) |
Description | Insulin-2 precursor [Contains: Insulin-2 B chain; Insulin-2 A chain]. |
Source organism | Xenopus laevis (African clawed frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 106 Amino acids |
Molecular weight | 12207 |
References | 1 PubMed abstract 2722842 2 PubMed abstract 2661211 |
Domain Name | Insulin |
Hormone Name | Insulin-2 B chain |
Mature Hormone Sequence | LANQHLCGSHLVEALYLVCGDRGFFYYPKI |
Position of mature hormone in Pre-Hormone protein | 30 Residues from position (24-53) |
Receptor | Q9PVZ4
Detail in HMRbase |
Gene ID | 378695 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11405 |
Swiss-prot Accession number | P12707 (Sequence in FASTA format) |
Description | Insulin-2 precursor [Contains: Insulin-2 B chain; Insulin-2 A chain]. |
Source organism | Xenopus laevis (African clawed frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 106 Amino acids |
Molecular weight | 12207 |
References | 1 PubMed abstract 2722842 2 PubMed abstract 2661211 |
Domain Name | Insulin |
Hormone Name | Insulin-2 A chain |
Mature Hormone Sequence | GIVEQCCHSTCSLFQLENYCN |
Position of mature hormone in Pre-Hormone protein | 21 Residues from position (86-106) |
Receptor | Q9PVZ4
Detail in HMRbase |
Gene ID | 378695 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |