![]() |
|
|
|
|
|
|
HMRbase accession number | 11389 |
Swiss-prot Accession number | P08998 (Sequence in FASTA format) |
Description | Somatotropin precursor (Growth hormone). |
Source organism | Gallus gallus (Chicken) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Growth hormone plays an important role in growth control |
Protein Length | 216 Amino acids |
Molecular weight | 24713 |
References | 1 PubMed abstract 3174454 2 Zhvirblis G.S., Gorbulev V.G., Rubtsov P.M., Karapetyan R.V.,Zhuravlev I.V., Fisinin V.I., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones: I. Cloning and primarystructure of cDNA of chicken growth hormone."; Mol. Biol. (Mosk.) 21:1324-1328(1987). 3 PubMed abstract 3482121 4 PubMed abstract 1975228 5 PubMed abstract 1555772 6 Ip S.C.Y., Chan C., Leung F.C.; "Chicken growth hormone genomic sequence (Yellow Wai Chow strain)."; Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases. 7 PubMed abstract 12960021 8 Sun B., Nie Q., Lei M., Zhang X.; "Single nucleotide polymorphisms of chicken whole growth hormone geneand their relation to growth traits."; Submitted (NOV-2003) to the EMBL/GenBank/DDBJ databases. |
Domain Name | Hormone_1 |
Hormone Name | Somatotropin |
Mature Hormone Sequence | TFPAMPLSNLFANAVLRAQHLHLLAAETYKEFERTYIPEDQRYTNKNSQAAFCYSETIPAPTGKDDAQQKSDMELLRFSLVLIQSWLTPVQYLSKVFTNNLVFGTSDRVFEKLKDLEEGIQALMRELEDRSPRGPQLLRPTYDKFDIHLRNEDALLKNYGLLSCFKKDLHKVETYLKVMKCRRFGESNCTI |
Position of mature hormone in Pre-Hormone protein | 191 Residues from position (26-216) |
Receptor | Q02092
Detail in HMRbase |
Gene ID | 378781 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |