A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	11350
Swiss-prot Accession number	P01352 (Sequence in FASTA format)
Description	Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Protein Length	104 Amino acids
Molecular weight	11573
References	1  PubMed abstract 2608050 2  PubMed abstract 1773057 3  PubMed abstract 5665711
Domain Name	Gastrin
Hormone Name	Big gastrin
Mature Hormone Sequence	QLGLQDPPHMVADLSKKQGPWVEEEEAAYGWMDF
Position of mature hormone in Pre-Hormone protein	34 Residues from position (59-92)
Receptor	P79266    Detail in HMRbase
Gene ID	280800
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 2

HMRbase accession number	11351
Swiss-prot Accession number	P01352 (Sequence in FASTA format)
Description	Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Protein Length	104 Amino acids
Molecular weight	11573
References	1  PubMed abstract 2608050 2  PubMed abstract 1773057 3  PubMed abstract 5665711
Domain Name	Gastrin
Hormone Name	Gastrin
Mature Hormone Sequence	QGPWVEEEEAAYGWMDF
Position of mature hormone in Pre-Hormone protein	17 Residues from position (76-92)
Receptor	P79266    Detail in HMRbase
Gene ID	280800
PDB ID	N/A
Drugpedia	wiki
Comments