A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	11336
Swiss-prot Accession number	P01308 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	11981
References	1  PubMed abstract 6243748 2  PubMed abstract 6248962 3  PubMed abstract 503234 4  PubMed abstract 6927840 5  PubMed abstract 8358440 6   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,Phelan M., Farmer A.; "Cloning of human full-length CDSs in BD Creator(TM) system donorvector."; Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases. 7  PubMed abstract 15489334 8   Fajardy I.I., Weill J.J., Stuckens C.C., Danze P.M.P.; "Description of a novel RFLP diallelic polymorphism (-127 BsgI C/G)within the 5' region of insulin gene."; Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases. 9  PubMed abstract 14426955 10  PubMed abstract 5101771 11  PubMed abstract 5560404 12  PubMed abstract 4443293 13  PubMed abstract 4803504 14  PubMed abstract 4698555 15  PubMed abstract 4698553 16  PubMed abstract 6312455 17  PubMed abstract 6424111 18  PubMed abstract 3470784 19  PubMed abstract 3537011 20  PubMed abstract 2196279 21  PubMed abstract 4019786 22  PubMed abstract 1601997 23  PubMed abstract 2271664 24  PubMed abstract 2036420 25  PubMed abstract 1646635 26  PubMed abstract 1433291 27  PubMed abstract 8421693 28  PubMed abstract 9235985
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	P06213    Detail in HMRbase
Gene ID	3630
PDB ID	1A7F   1AI0   1AIY   1B9E   1BEN   1EFE   1EV3   1EV6   1EVR   1FU2   1FUB   1G7A   1G7B   1GUJ   1HIQ   1HIS   1HIT   1HLS   1HTV   1HUI   1IOG   1IOH   1J73   1JCA   1JCO   1K3M   1KMF   1LKQ   1LPH   1MHI   1MHJ   1MSO   1OS3   1OS4   1QIY   1QIZ   1QJ0   1RWE   1SF1   1SJT   1SJU   1T0C   1T1K   1T1P   1T1Q   1TRZ   1TYL   1TYM   1UZ9   1VKT   1W8P
Drugpedia	wiki
Comments

Search Result - 2

HMRbase accession number	11337
Swiss-prot Accession number	P01308 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	11981
References	1  PubMed abstract 6243748 2  PubMed abstract 6248962 3  PubMed abstract 503234 4  PubMed abstract 6927840 5  PubMed abstract 8358440 6   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,Phelan M., Farmer A.; "Cloning of human full-length CDSs in BD Creator(TM) system donorvector."; Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases. 7  PubMed abstract 15489334 8   Fajardy I.I., Weill J.J., Stuckens C.C., Danze P.M.P.; "Description of a novel RFLP diallelic polymorphism (-127 BsgI C/G)within the 5' region of insulin gene."; Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases. 9  PubMed abstract 14426955 10  PubMed abstract 5101771 11  PubMed abstract 5560404 12  PubMed abstract 4443293 13  PubMed abstract 4803504 14  PubMed abstract 4698555 15  PubMed abstract 4698553 16  PubMed abstract 6312455 17  PubMed abstract 6424111 18  PubMed abstract 3470784 19  PubMed abstract 3537011 20  PubMed abstract 2196279 21  PubMed abstract 4019786 22  PubMed abstract 1601997 23  PubMed abstract 2271664 24  PubMed abstract 2036420 25  PubMed abstract 1646635 26  PubMed abstract 1433291 27  PubMed abstract 8421693 28  PubMed abstract 9235985
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	P06213    Detail in HMRbase
Gene ID	3630
PDB ID	1A7F   1AI0   1AIY   1B9E   1BEN   1EFE   1EV3   1EV6   1EVR   1FU2   1FUB   1G7A   1G7B   1GUJ   1HIQ   1HIS   1HIT   1HLS   1HTV   1HUI   1IOG   1IOH   1J73   1JCA   1JCO   1K3M   1KMF   1LKQ   1LPH   1MHI   1MHJ   1MSO   1OS3   1OS4   1QIY   1QIZ   1QJ0   1RWE   1SF1   1SJT   1SJU   1T0C   1T1K   1T1P   1T1Q   1TRZ   1TYL   1TYM   1UZ9   1VKT   1W8P
Drugpedia	wiki
Comments